Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|508
Gene name
LocationContig_11:43122..44662
Strand+
Gene length (bp)1540
Transcript length (bp)1185
Coding sequence length (bp)1185
Protein length (aa) 395

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02386 TrkH Cation transport protein 3.8E-06 332 394

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P28569|TRK1_SACUV High-affinity potassium transport protein OS=Saccharomyces uvarum GN=TRK1 PE=3 SV=1 22 105 4.0E-11
sp|P12685|TRK1_YEAST High-affinity potassium transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRK1 PE=1 SV=1 22 105 9.0E-10
sp|P28584|TRK2_YEAST Low-affinity potassium transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRK2 PE=1 SV=1 22 105 3.0E-09
sp|Q10065|TRK2_SCHPO Potassium transport protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trk2 PE=2 SV=1 20 105 4.0E-07
sp|P28569|TRK1_SACUV High-affinity potassium transport protein OS=Saccharomyces uvarum GN=TRK1 PE=3 SV=1 331 394 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P28569|TRK1_SACUV High-affinity potassium transport protein OS=Saccharomyces uvarum GN=TRK1 PE=3 SV=1 22 105 4.0E-11
sp|P12685|TRK1_YEAST High-affinity potassium transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRK1 PE=1 SV=1 22 105 9.0E-10
sp|P28584|TRK2_YEAST Low-affinity potassium transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRK2 PE=1 SV=1 22 105 3.0E-09
sp|Q10065|TRK2_SCHPO Potassium transport protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trk2 PE=2 SV=1 20 105 4.0E-07
sp|P28569|TRK1_SACUV High-affinity potassium transport protein OS=Saccharomyces uvarum GN=TRK1 PE=3 SV=1 331 394 2.0E-06
sp|P12685|TRK1_YEAST High-affinity potassium transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRK1 PE=1 SV=1 331 394 2.0E-06
sp|P47946|TRK1_SCHPO Potassium transport protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trk1 PE=3 SV=2 22 142 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008324 cation transmembrane transporter activity Yes
GO:0006812 cation transport Yes
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0006811 ion transport No
GO:0015075 ion transmembrane transporter activity No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 71 93 22
3 353 375 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|508
MEKRSGVLLWPGRAADRSPDAWVILLGLLALPVMYPYGNLQAIDAYFFGASAATESGLNTYDCKELALYQQLYIY
FIPLITNLGFINILVVLVRLHWFRKRIDKIGHALLAARRQRFTPDQAPGSTSDDASVDLETGVESRRPGSAGAET
GEKAAPLRIQDASAASSDGWLREKPGAATSQSAGPDGRTASSGGLEDRQVVPVDASTDTDLSSRPGEDAQSALSV
HLAGSRDTTPDSGRGASTRSAKSLQDEKRVSVRDGEACARAGQCGPSRDLRRSRHPLRRILGKASAVLRLRSKGA
GGCRARTEYRCRASGDGTARRLAGVDGPDRLTAEDRDELGGVEYRSLKLLLKIITAYFFGVHLLGGLGMLGWVQY
ADPKYRTYLAEQGLNKSWW*
Coding >Hirsu2|508
ATGGAGAAAAGGAGTGGCGTGTTGCTGTGGCCGGGACGCGCCGCTGACCGCTCGCCAGATGCTTGGGTTATCCTG
CTCGGCCTGCTGGCGCTGCCGGTCATGTATCCGTACGGGAACCTGCAGGCCATCGACGCCTACTTCTTCGGCGCC
AGCGCGGCGACGGAGTCGGGCCTCAACACCTATGACTGCAAGGAGCTGGCGCTGTACCAGCAGCTGTACATCTAC
TTCATCCCCCTGATCACGAACCTGGGCTTCATCAACATCTTGGTCGTGCTCGTGCGGCTGCACTGGTTCCGCAAG
CGCATCGACAAGATAGGCCATGCTCTCCTCGCGGCCCGCCGCCAGCGCTTCACACCCGATCAGGCGCCCGGCAGC
ACGTCGGACGACGCCAGCGTGGACCTGGAAACGGGCGTCGAGAGCCGGCGCCCTGGCTCGGCCGGCGCGGAGACC
GGAGAGAAGGCGGCCCCGTTGCGGATCCAGGACGCGTCCGCGGCCTCGAGCGACGGTTGGCTCCGCGAGAAGCCG
GGCGCGGCGACATCGCAGTCCGCCGGTCCGGACGGCCGGACCGCGAGCAGCGGCGGGCTCGAGGACAGGCAGGTC
GTGCCCGTCGATGCCAGCACCGACACGGACTTGTCCTCCCGGCCGGGAGAAGACGCCCAATCCGCCTTGTCCGTC
CACTTGGCCGGCTCCCGCGACACGACTCCCGACAGCGGCAGGGGTGCCTCGACCAGGTCCGCTAAGTCGCTCCAA
GATGAAAAGCGGGTGAGCGTGCGGGACGGCGAGGCATGCGCCCGCGCCGGCCAGTGCGGCCCGAGTCGCGACTTG
CGCCGGTCCCGCCATCCTCTCCGTCGGATTCTCGGCAAGGCATCGGCCGTGCTCCGTCTCCGCTCGAAAGGCGCG
GGCGGGTGCCGGGCGCGGACCGAGTACCGGTGCCGGGCCTCGGGAGACGGGACGGCCCGCCGTCTAGCCGGCGTC
GACGGCCCGGACCGGCTTACGGCCGAGGACCGCGACGAGCTCGGCGGGGTGGAATATCGGAGCCTGAAACTGTTG
CTCAAAATCATCACCGCGTACTTCTTCGGCGTTCATCTTCTCGGCGGCCTCGGCATGCTGGGCTGGGTGCAGTAT
GCCGATCCCAAGTACCGGACGTATCTGGCGGAGCAGGGGCTGAACAAGAGCTGGTGGTGA
Transcript >Hirsu2|508
ATGGAGAAAAGGAGTGGCGTGTTGCTGTGGCCGGGACGCGCCGCTGACCGCTCGCCAGATGCTTGGGTTATCCTG
CTCGGCCTGCTGGCGCTGCCGGTCATGTATCCGTACGGGAACCTGCAGGCCATCGACGCCTACTTCTTCGGCGCC
AGCGCGGCGACGGAGTCGGGCCTCAACACCTATGACTGCAAGGAGCTGGCGCTGTACCAGCAGCTGTACATCTAC
TTCATCCCCCTGATCACGAACCTGGGCTTCATCAACATCTTGGTCGTGCTCGTGCGGCTGCACTGGTTCCGCAAG
CGCATCGACAAGATAGGCCATGCTCTCCTCGCGGCCCGCCGCCAGCGCTTCACACCCGATCAGGCGCCCGGCAGC
ACGTCGGACGACGCCAGCGTGGACCTGGAAACGGGCGTCGAGAGCCGGCGCCCTGGCTCGGCCGGCGCGGAGACC
GGAGAGAAGGCGGCCCCGTTGCGGATCCAGGACGCGTCCGCGGCCTCGAGCGACGGTTGGCTCCGCGAGAAGCCG
GGCGCGGCGACATCGCAGTCCGCCGGTCCGGACGGCCGGACCGCGAGCAGCGGCGGGCTCGAGGACAGGCAGGTC
GTGCCCGTCGATGCCAGCACCGACACGGACTTGTCCTCCCGGCCGGGAGAAGACGCCCAATCCGCCTTGTCCGTC
CACTTGGCCGGCTCCCGCGACACGACTCCCGACAGCGGCAGGGGTGCCTCGACCAGGTCCGCTAAGTCGCTCCAA
GATGAAAAGCGGGTGAGCGTGCGGGACGGCGAGGCATGCGCCCGCGCCGGCCAGTGCGGCCCGAGTCGCGACTTG
CGCCGGTCCCGCCATCCTCTCCGTCGGATTCTCGGCAAGGCATCGGCCGTGCTCCGTCTCCGCTCGAAAGGCGCG
GGCGGGTGCCGGGCGCGGACCGAGTACCGGTGCCGGGCCTCGGGAGACGGGACGGCCCGCCGTCTAGCCGGCGTC
GACGGCCCGGACCGGCTTACGGCCGAGGACCGCGACGAGCTCGGCGGGGTGGAATATCGGAGCCTGAAACTGTTG
CTCAAAATCATCACCGCGTACTTCTTCGGCGTTCATCTTCTCGGCGGCCTCGGCATGCTGGGCTGGGTGCAGTAT
GCCGATCCCAAGTACCGGACGTATCTGGCGGAGCAGGGGCTGAACAAGAGCTGGTGGTGA
Gene >Hirsu2|508
ATGGAGAAAAGGAGTGGCGTGTTGCTGTGGCCGGGACGCGCCGCTGACCGCTCGCCAGATGCTTGGGTTATCCTG
CTCGGCCTGCTGGCGCTGCCGGTCATGTATCCGTACGGGAACCTGCAGGCCATCGACGCCTACTTCTTCGGCGCC
AGCGCGGCGACGGAGTCGGGCCTCAACACGTGCGTTGCGACGGGCATGCCCCTGCCGCCCGCCTGGTGACGGTGT
TGGCTGATGCGGAGCGAGGACAGCTATGACTGCAAGGAGCTGGCGCTGTACCAGCAGCTGTACATCTACTTCATC
CCCCTGATCACGAACCTGGGCTTCATCAACATCTTGGTCGTGCTCGTGCGGCTGCACTGGTTCCGCAAGCGCATC
GACAAGATAGGTATGTTGGTTTTGGTTTTGGTTTTTGTTTGCTGCGGCCGTGTCAAGGGCAACTCACTCCAACAT
GTCGATGTTTCTTGGACGTGGTGGCTGATACCGCTCGCGTGTAGGCCATGCTCTCCTCGCGGCCCGCCGCCAGCG
CTTCACACCCGATCAGGCGCCCGGCAGCACGTCGGACGACGCCAGCGTGGACCTGGAAACGGGCGTCGAGAGCCG
GCGCCCTGGCTCGGCCGGCGCGGAGACCGGAGAGAAGGCGGCCCCGTTGCGGATCCAGGACGCGTCCGCGGCCTC
GAGCGACGGTTGGCTCCGCGAGAAGCCGGGCGCGGCGACATCGCAGTCCGCCGGTCCGGACGGCCGGACCGCGAG
CAGCGGCGGGCTCGAGGACAGGCAGGTCGTGCCCGTCGATGCCAGCACCGACACGGACTTGTCCTCCCGGCCGGG
AGAAGACGGTACGTCCAGGTCGCAGCCCGTCCAGCTGAGTTGTCCCCCTTGTCGAGAAGCCGACGGGCTGGTTCT
GACGCGCTGTGCTACGTAGCCCAATCCGCCTTGTCCGTCCACTTGGCCGGCTCCCGCGACACGACTCCCGACAGC
GGCAGGGGTGCCTCGACCAGGTCCGCTAAGTCGCTCCAAGATGAAAAGCGGGTGAGCGTGCGGGACGGCGAGGCA
TGCGCCCGCGCCGGCCAGTGCGGCCCGAGTCGCGACTTGCGCCGGTCCCGCCATCCTCTCCGTCGGATTCTCGGC
AAGGCATCGGCCGTGCTCCGTCTCCGCTCGAAAGGCGCGGGCGGGTGCCGGGCGCGGACCGAGTACCGGTGCCGG
GCCTCGGGAGACGGGACGGCCCGCCGTCTAGCCGGCGTCGACGGCCCGGACCGGCTTACGGCCGAGGACCGCGAC
GAGCTCGGCGGGGTGGAATATCGGAGCCTGAAACTGTTGCTCAAAATCATCACCGGTGCGTTTTGTTTCTTTCGG
CTGTTGCTGCTCGTGCCCACGCTCCTTGCAGGGGAGAGCCGGTCTGACTGTTTTTTGTTTTTTCGAGGCAGCGTA
CTTCTTCGGCGTTCATCTTCTCGGCGGCCTCGGCATGCTGGGCTGGGTGCAGTATGCCGATCCCAAGTACCGGAC
GTATCTGGCGGAGCAGGGGCTGAACAAGAGCTGGTGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail