Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5070
Gene name
LocationContig_254:16895..19115
Strand-
Gene length (bp)2220
Transcript length (bp)2082
Coding sequence length (bp)2082
Protein length (aa) 694

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain 6.9E-09 17 181
PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain 3.1E-08 417 535
PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2 1.6E-06 327 377

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P77989|BGAL_THEP3 Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=lacZ PE=3 SV=2 119 517 3.0E-21
sp|A4W7D2|BGAL_ENT38 Beta-galactosidase OS=Enterobacter sp. (strain 638) GN=lacZ PE=3 SV=1 145 532 6.0E-15
sp|O18835|BGLR_CANLF Beta-glucuronidase OS=Canis lupus familiaris GN=GUSB PE=1 SV=1 120 533 1.0E-14
sp|A3FEW8|BGAL_ENTAG Beta-galactosidase OS=Enterobacter agglomerans GN=lacZ PE=1 SV=2 145 532 5.0E-14
sp|P06760|BGLR_RAT Beta-glucuronidase OS=Rattus norvegicus GN=Gusb PE=2 SV=1 120 533 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P77989|BGAL_THEP3 Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=lacZ PE=3 SV=2 119 517 3.0E-21
sp|A4W7D2|BGAL_ENT38 Beta-galactosidase OS=Enterobacter sp. (strain 638) GN=lacZ PE=3 SV=1 145 532 6.0E-15
sp|O18835|BGLR_CANLF Beta-glucuronidase OS=Canis lupus familiaris GN=GUSB PE=1 SV=1 120 533 1.0E-14
sp|A3FEW8|BGAL_ENTAG Beta-galactosidase OS=Enterobacter agglomerans GN=lacZ PE=1 SV=2 145 532 5.0E-14
sp|P06760|BGLR_RAT Beta-glucuronidase OS=Rattus norvegicus GN=Gusb PE=2 SV=1 120 533 2.0E-13
sp|O97524|BGLR_FELCA Beta-glucuronidase OS=Felis catus GN=GUSB PE=1 SV=1 120 533 4.0E-13
sp|P08236|BGLR_HUMAN Beta-glucuronidase OS=Homo sapiens GN=GUSB PE=1 SV=2 120 532 3.0E-12
sp|P06864|BGA2_ECOLI Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) GN=ebgA PE=1 SV=4 131 533 5.0E-12
sp|Q4FAT7|BGLR_PIG Beta-glucuronidase OS=Sus scrofa GN=GUSB PE=3 SV=1 120 533 1.0E-11
sp|O77695|BGLR_CHLAE Beta-glucuronidase (Fragment) OS=Chlorocebus aethiops GN=GUSB PE=2 SV=1 120 532 2.0E-11
sp|P05804|BGLR_ECOLI Beta-glucuronidase OS=Escherichia coli (strain K12) GN=uidA PE=1 SV=2 91 532 2.0E-11
sp|Q5R5N6|BGLR_PONAB Beta-glucuronidase OS=Pongo abelii GN=GUSB PE=2 SV=2 120 532 3.0E-11
sp|Q2XQU3|BGAL2_ENTCL Beta-galactosidase 2 OS=Enterobacter cloacae GN=lacZ PE=3 SV=1 145 537 4.0E-11
sp|P12265|BGLR_MOUSE Beta-glucuronidase OS=Mus musculus GN=Gusb PE=1 SV=2 120 533 2.0E-10
sp|A0KQH4|BGAL_AERHH Beta-galactosidase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=lacZ PE=3 SV=1 312 537 6.0E-10
sp|Q02603|BGAL_LEULA Beta-galactosidase large subunit OS=Leuconostoc lactis GN=lacL PE=1 SV=1 137 521 9.0E-10
sp|A1SWB8|BGAL_PSYIN Beta-galactosidase OS=Psychromonas ingrahamii (strain 37) GN=lacZ PE=3 SV=1 344 532 1.0E-09
sp|Q9K9C6|BGAL_BACHD Beta-galactosidase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=lacZ PE=3 SV=1 141 533 1.0E-09
sp|P00723|BGAL_KLULA Beta-galactosidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC4 PE=1 SV=2 143 548 1.0E-09
sp|Q7MG04|BGAL_VIBVY Beta-galactosidase OS=Vibrio vulnificus (strain YJ016) GN=lacZ PE=3 SV=1 344 532 3.0E-09
sp|Q8D4H3|BGAL_VIBVU Beta-galactosidase OS=Vibrio vulnificus (strain CMCP6) GN=lacZ PE=3 SV=2 344 532 3.0E-09
sp|B2VHN8|BGAL_ERWT9 Beta-galactosidase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=lacZ PE=3 SV=1 145 537 5.0E-09
sp|A1JTC4|BGAL_YERE8 Beta-galactosidase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=lacZ PE=3 SV=1 145 537 7.0E-09
sp|A7LXS9|BGH2A_BACO1 Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02645 PE=1 SV=1 121 536 7.0E-09
sp|A4TLL5|BGAL_YERPP Beta-galactosidase OS=Yersinia pestis (strain Pestoides F) GN=lacZ PE=3 SV=1 145 537 3.0E-08
sp|Q1C6T8|BGAL_YERPA Beta-galactosidase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=lacZ PE=3 SV=1 145 537 3.0E-08
sp|Q7CIZ3|BGAL_YERPE Beta-galactosidase OS=Yersinia pestis GN=lacZ PE=3 SV=1 145 537 3.0E-08
sp|Q1CI76|BGAL_YERPN Beta-galactosidase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=lacZ PE=3 SV=1 145 537 3.0E-08
sp|A9R0J8|BGAL_YERPG Beta-galactosidase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=lacZ PE=3 SV=1 145 537 3.0E-08
sp|B1LIM9|BGAL_ECOSM Beta-galactosidase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=lacZ PE=3 SV=1 145 537 3.0E-08
sp|A7FH78|BGAL_YERP3 Beta-galactosidase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=lacZ PE=3 SV=1 145 537 3.0E-08
sp|B2K6E6|BGAL_YERPB Beta-galactosidase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=lacZ PE=3 SV=1 145 537 3.0E-08
sp|Q669R9|BGAL_YERPS Beta-galactosidase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=lacZ PE=3 SV=1 145 537 3.0E-08
sp|B1JI86|BGAL_YERPY Beta-galactosidase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=lacZ PE=3 SV=1 145 537 3.0E-08
sp|A8GGN3|BGAL_SERP5 Beta-galactosidase OS=Serratia proteamaculans (strain 568) GN=lacZ PE=3 SV=1 342 537 8.0E-08
sp|O52847|BGAL_BACMD Beta-galactosidase OS=Bacillus megaterium (strain DSM 319) GN=bgaM PE=3 SV=1 131 560 1.0E-07
sp|B4S2K9|BGAL_ALTMD Beta-galactosidase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=lacZ PE=3 SV=1 344 532 8.0E-07
sp|Q48727|BGAL_LACLA Beta-galactosidase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lacZ PE=3 SV=3 343 537 3.0E-06
sp|Q04F24|BGAL_OENOB Beta-galactosidase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=lacZ PE=3 SV=1 145 521 6.0E-06
sp|Q3Z583|BGAL_SHISS Beta-galactosidase OS=Shigella sonnei (strain Ss046) GN=lacZ PE=3 SV=1 145 537 7.0E-06
sp|Q8FKG6|BGAL_ECOL6 Beta-galactosidase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lacZ PE=3 SV=1 145 537 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5070
MQPYPRPDFERSGLSWQSLNGPWQFLFDDDDVGLMDRWAQNGLPQEVVVKAARETTGAAGHSENDTITQRIAAGT
QELIKDNAFATSAAESVNRRRTIQVPFVFQCPASGIDDRGVHEVLWYERAIADPRTARDKDRGRRLLLRFGAVDY
DARVWVNGRFVGGHRGGHVPFDLDVTEAIEADTAVSAQPSSHRLTVRVYDSAYDLTQPRGKQYWGAKPESIFYTP
SGGIWQSVWIEVVPPARIADSSHGTLLQSTDIGSGKLKCHISVFGRRQGQACSIQVEAGLAGIVVAVSDKKSLPK
EASSVDLELDMRLSREQQSLLSSSVTDGAPLSNQRCWLDGVALWSPEHPLLYNVTIRLFDSQSGTLLDEVKSLTG
MRSIEWSRGDGSWRLNGRPYFQALCLDQGYWPDSFMTPPSQDSVKLDIELAKRMGFNGCRKHQKVEDPIFYYWAD
RLGYLVWAEMANSYHFSAAYVDRFNQEWAEAVKLAINHPSVVTWTPVNESWGYPSLKDRAEQQDHVRALYYLTKS
LDPTRSINDNCGWEHVCTDLTTFHDYSDGPDLEKTCASLDLILGPKAGRDLFVGGAQHRPGAPIMCTEFGGVNIA
PAKVKADDSASDRDWGYTTASDSLDLLARFERLVKGVTQGGHCYAFVYTQLTDIEQEANGLYTFHRKEKLDAGKV
KAVIEEALRAFYTKVDSS*
Coding >Hirsu2|5070
ATGCAACCCTATCCACGACCCGATTTCGAGCGCAGCGGCCTGAGCTGGCAGTCGCTGAATGGGCCGTGGCAATTT
CTCTTCGACGACGATGACGTCGGCCTGATGGACCGCTGGGCGCAGAATGGCCTGCCGCAGGAGGTGGTCGTCAAG
GCTGCGCGAGAGACAACCGGAGCTGCCGGCCACTCCGAAAACGACACCATCACGCAGCGCATCGCCGCCGGTACC
CAGGAGCTCATCAAAGATAACGCCTTTGCCACGAGCGCTGCAGAATCCGTCAATCGCCGCCGCACCATCCAAGTG
CCTTTCGTCTTCCAATGCCCCGCCTCGGGCATCGACGATCGCGGGGTCCACGAGGTGCTATGGTACGAGCGGGCC
ATTGCGGATCCTCGTACGGCCCGGGACAAGGACCGGGGCCGGAGGCTGCTGCTCCGATTCGGCGCTGTCGATTAC
GACGCCCGCGTCTGGGTCAATGGTCGCTTCGTTGGAGGCCACAGAGGCGGACACGTACCGTTCGACCTTGACGTG
ACGGAAGCCATCGAAGCAGATACTGCTGTCTCGGCCCAGCCTTCCTCGCATCGTCTTACTGTGAGGGTTTACGAT
TCCGCCTACGACCTGACGCAACCGCGCGGCAAGCAGTATTGGGGCGCAAAGCCGGAGAGCATCTTCTACACGCCC
TCGGGCGGCATCTGGCAGTCAGTCTGGATCGAGGTCGTTCCGCCAGCCAGGATCGCCGACAGCTCACACGGCACT
CTTTTGCAATCAACCGACATTGGCTCTGGCAAGCTGAAATGCCACATCTCCGTGTTCGGCAGACGGCAGGGACAG
GCTTGCAGCATCCAGGTGGAGGCGGGGCTTGCTGGCATAGTCGTGGCGGTCTCAGACAAGAAGTCCCTACCTAAA
GAGGCCAGCTCGGTAGATCTGGAGCTCGACATGCGACTGTCTCGAGAGCAGCAGTCCCTTCTGTCTTCTTCCGTC
ACCGACGGCGCGCCGCTCAGCAATCAACGGTGCTGGCTCGACGGCGTGGCCCTGTGGTCACCAGAACATCCTCTT
CTATACAATGTCACGATCCGGCTTTTTGACTCTCAGTCGGGGACGCTCCTGGACGAGGTCAAGTCGCTCACTGGA
ATGCGCTCTATTGAATGGTCTCGAGGTGATGGCTCGTGGAGGTTGAACGGTAGACCCTACTTCCAGGCGCTGTGC
CTCGACCAAGGTTATTGGCCCGACTCCTTCATGACCCCTCCGAGCCAGGACAGTGTCAAGCTCGACATCGAGCTG
GCCAAGCGCATGGGCTTCAACGGCTGCCGCAAACACCAGAAAGTCGAGGACCCCATTTTCTACTACTGGGCCGAC
AGACTTGGCTACCTCGTCTGGGCGGAAATGGCCAATTCGTATCACTTCAGCGCCGCATACGTCGACCGCTTCAAC
CAAGAGTGGGCCGAGGCCGTCAAGCTTGCCATCAACCACCCGTCCGTCGTGACCTGGACTCCTGTCAACGAGAGC
TGGGGCTACCCATCCCTGAAGGACCGCGCGGAGCAGCAGGATCACGTACGAGCACTGTACTATCTAACTAAGTCT
CTTGACCCCACGAGAAGCATCAATGACAACTGTGGCTGGGAGCACGTCTGCACCGATCTCACAACCTTCCACGAC
TACAGTGACGGACCCGATCTGGAAAAGACGTGTGCCAGTTTGGATCTTATCCTTGGTCCCAAGGCGGGGAGAGAC
TTGTTCGTCGGCGGTGCTCAGCACCGGCCCGGGGCCCCCATCATGTGCACCGAGTTTGGCGGCGTCAACATCGCG
CCGGCCAAAGTCAAGGCAGACGACAGCGCCTCGGACCGCGACTGGGGGTACACTACCGCCAGCGACTCCCTGGAC
CTGCTAGCCAGATTCGAGAGATTGGTCAAGGGCGTCACACAAGGCGGCCACTGCTATGCGTTCGTGTACACGCAG
CTGACTGACATTGAACAAGAGGCCAACGGTCTCTATACCTTCCATCGCAAGGAAAAGTTGGATGCTGGCAAGGTC
AAGGCTGTCATCGAGGAGGCTTTGCGGGCGTTTTACACAAAAGTCGATTCTTCGTAG
Transcript >Hirsu2|5070
ATGCAACCCTATCCACGACCCGATTTCGAGCGCAGCGGCCTGAGCTGGCAGTCGCTGAATGGGCCGTGGCAATTT
CTCTTCGACGACGATGACGTCGGCCTGATGGACCGCTGGGCGCAGAATGGCCTGCCGCAGGAGGTGGTCGTCAAG
GCTGCGCGAGAGACAACCGGAGCTGCCGGCCACTCCGAAAACGACACCATCACGCAGCGCATCGCCGCCGGTACC
CAGGAGCTCATCAAAGATAACGCCTTTGCCACGAGCGCTGCAGAATCCGTCAATCGCCGCCGCACCATCCAAGTG
CCTTTCGTCTTCCAATGCCCCGCCTCGGGCATCGACGATCGCGGGGTCCACGAGGTGCTATGGTACGAGCGGGCC
ATTGCGGATCCTCGTACGGCCCGGGACAAGGACCGGGGCCGGAGGCTGCTGCTCCGATTCGGCGCTGTCGATTAC
GACGCCCGCGTCTGGGTCAATGGTCGCTTCGTTGGAGGCCACAGAGGCGGACACGTACCGTTCGACCTTGACGTG
ACGGAAGCCATCGAAGCAGATACTGCTGTCTCGGCCCAGCCTTCCTCGCATCGTCTTACTGTGAGGGTTTACGAT
TCCGCCTACGACCTGACGCAACCGCGCGGCAAGCAGTATTGGGGCGCAAAGCCGGAGAGCATCTTCTACACGCCC
TCGGGCGGCATCTGGCAGTCAGTCTGGATCGAGGTCGTTCCGCCAGCCAGGATCGCCGACAGCTCACACGGCACT
CTTTTGCAATCAACCGACATTGGCTCTGGCAAGCTGAAATGCCACATCTCCGTGTTCGGCAGACGGCAGGGACAG
GCTTGCAGCATCCAGGTGGAGGCGGGGCTTGCTGGCATAGTCGTGGCGGTCTCAGACAAGAAGTCCCTACCTAAA
GAGGCCAGCTCGGTAGATCTGGAGCTCGACATGCGACTGTCTCGAGAGCAGCAGTCCCTTCTGTCTTCTTCCGTC
ACCGACGGCGCGCCGCTCAGCAATCAACGGTGCTGGCTCGACGGCGTGGCCCTGTGGTCACCAGAACATCCTCTT
CTATACAATGTCACGATCCGGCTTTTTGACTCTCAGTCGGGGACGCTCCTGGACGAGGTCAAGTCGCTCACTGGA
ATGCGCTCTATTGAATGGTCTCGAGGTGATGGCTCGTGGAGGTTGAACGGTAGACCCTACTTCCAGGCGCTGTGC
CTCGACCAAGGTTATTGGCCCGACTCCTTCATGACCCCTCCGAGCCAGGACAGTGTCAAGCTCGACATCGAGCTG
GCCAAGCGCATGGGCTTCAACGGCTGCCGCAAACACCAGAAAGTCGAGGACCCCATTTTCTACTACTGGGCCGAC
AGACTTGGCTACCTCGTCTGGGCGGAAATGGCCAATTCGTATCACTTCAGCGCCGCATACGTCGACCGCTTCAAC
CAAGAGTGGGCCGAGGCCGTCAAGCTTGCCATCAACCACCCGTCCGTCGTGACCTGGACTCCTGTCAACGAGAGC
TGGGGCTACCCATCCCTGAAGGACCGCGCGGAGCAGCAGGATCACGTACGAGCACTGTACTATCTAACTAAGTCT
CTTGACCCCACGAGAAGCATCAATGACAACTGTGGCTGGGAGCACGTCTGCACCGATCTCACAACCTTCCACGAC
TACAGTGACGGACCCGATCTGGAAAAGACGTGTGCCAGTTTGGATCTTATCCTTGGTCCCAAGGCGGGGAGAGAC
TTGTTCGTCGGCGGTGCTCAGCACCGGCCCGGGGCCCCCATCATGTGCACCGAGTTTGGCGGCGTCAACATCGCG
CCGGCCAAAGTCAAGGCAGACGACAGCGCCTCGGACCGCGACTGGGGGTACACTACCGCCAGCGACTCCCTGGAC
CTGCTAGCCAGATTCGAGAGATTGGTCAAGGGCGTCACACAAGGCGGCCACTGCTATGCGTTCGTGTACACGCAG
CTGACTGACATTGAACAAGAGGCCAACGGTCTCTATACCTTCCATCGCAAGGAAAAGTTGGATGCTGGCAAGGTC
AAGGCTGTCATCGAGGAGGCTTTGCGGGCGTTTTACACAAAAGTCGATTCTTCGTAG
Gene >Hirsu2|5070
ATGCAACCCTATCCACGACCCGATTTCGAGCGCAGCGGCCTGAGCTGGCAGTCGCTGAATGGGCCGTGGCAATTT
CTCTTCGACGACGATGACGTCGGCCTGATGGACCGCTGGGCGCAGAATGGCCTGCCGCAGGAGGTGGTCGTCAAG
GCTGCGCGAGAGACAACCGGAGCTGCCGGCCACTCCGAAAACGACACCATCACGCAGCGCATCGCCGCCGGTACC
CAGGAGCTCATCAAAGATAACGCCTTTGCCACGAGCGCTGCAGAATCCGTCAATCGCCGCCGCACCATCCAAGTG
CCTTTCGTCTTCCAATGCCCCGCCTCGGGCATCGACGATCGCGGGGTCCACGAGGTGCTATGGTACGAGCGGGCC
ATTGCGGATCCTCGTACGGCCCGGGACAAGGACCGGGGCCGGAGGCTGCTGCTCCGATTCGGCGCTGTCGATTAC
GACGCCCGCGTCTGGGTCAATGGTCGCTTCGTTGGAGGCCACAGAGGCGGACACGTACCGTTCGACCTTGACGTG
ACGGAAGCCATCGAAGCAGATACTGCTGTCTCGGCCCAGCCTTCCTCGCATCGTCTTACTGTGAGGGTTTACGAT
TCCGCCTACGACCTGACGCAACCGCGCGGCAAGCAGTATTGGGGCGCAAAGCCGGAGAGCATCTTCTACACGCCC
TCGGGCGGCATCTGGCAGTCAGTCTGGATCGAGGTCGTTCCGCCAGCCAGGATCGCCGACAGCTCACACGGCACT
CTTTTGCAATCAACCGACATTGGCTCTGGCAAGCTGAAATGCCACATCTCCGTGTTCGGCAGACGGCAGGGACAG
GCTTGCAGCATCCAGGTGGAGGCGGGGCTTGCTGGCATAGTCGTGGCGGTCTCAGACAAGAAGTCCCTACCTAAA
GAGGCCAGCTCGGTAGATCTGGAGCTCGACATGCGACTGTCTCGAGAGCAGCAGTCCCTTCTGTCTTCTTCCGTC
ACCGACGGCGCGCCGCTCAGCAATCAACGGTGCTGGCTCGACGGCGTGGCCCTGTGGTCACCAGAACATCCTCTT
CTATACAATGTCACGATCCGGCTTTTTGACTCTCAGTCGGGGACGCTCCTGGACGAGGTCAAGTCGCTCACTGGA
ATGCGCTCTATTGAATGGTCTCGAGGTGATGGCTCGTGGAGGTTGAACGGTAGACCCTACTTCCAGGCGCTGTGC
CTCGACCAAGGTTATTGGCCCGACTCCTTCATGACCCCTCCGAGCCAGGACAGTGTCAAGCTCGACATCGAGCTG
GCCAAGCGCATGGGCTTCAACGGCTGCCGCAAACACCAGAAAGTCGAGGACCCCATTTTCTACTACTGGGCCGAC
AGACTTGGCTACCTCGTCTGGGCGGAAATGGCCAATTCGTATCACTTCAGCGCCGCATACGTCGACCGCTTCAAC
CAAGAGTGGGCCGAGGCCGTCAAGCTTGCCATCAACCACCCGTCCGTCGTGACCTGGACTCCTGTCAACGAGAGC
TGGGGCTACCCATCCCTGAAGGACCGCGCGGAGCAGCAGGATCACGTACGAGCACTGTACTATCTAACTAAGTAG
GTTCACAGACTTACTTGCCGACCAATGTTCAATGTTCTTGGGCTGACATCCATCCCCCCACAGGTCTCTTGACCC
CACGAGAAGCATCAATGACAACTGTGGCTGGGAGCACGTCTGCACCGATCTCACAACCTTCCACGACTACAGTGA
CGGACCCGATCTGGAAAAGACGTGTGCCAGTTTGGATCTTATCCTTGGTCCCAAGGCGGGGAGAGACTTGTTCGT
CGGCGGTGCTCAGCACCGGCCCGGGGCCCCCATCATGTGCACCGAGTTTGGCGGCGTCAACATCGCGCCGGCCAA
AGTCAAGGCAGACGACAGCGCCTCGGACCGCGACTGGGGGTACACTACCGCCAGCGACTCCCTGGACCTGCTAGC
CAGATTCGAGAGATTGGTCAAGGGCGTCACACAAGGCGGCCACTGCTATGCGTTCGTGTACACGCAGCTGTAAGT
TTCCAGATCGCCGGGGGAATGCTTCGTGCCGGCTCTCTCAGCAGACGACTAACCGTTGCGCGCAGGACTGACATT
GAACAAGAGGCCAACGGTCTCTATACCTTCCATCGCAAGGAAAAGTTGGATGCTGGCAAGGTCAAGGCTGTCATC
GAGGAGGCTTTGCGGGCGTTTTACACAAAAGTCGATTCTTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail