Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5054
Gene name
LocationContig_2535:128..1211
Strand+
Gene length (bp)1083
Transcript length (bp)912
Coding sequence length (bp)912
Protein length (aa) 304

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13434 K_oxygenase L-lysine 6-monooxygenase (NADPH-requiring) 7.0E-39 7 198

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|E9QYP0|SIDA_ASPFU L-ornithine N(5)-monooxygenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sidA PE=1 SV=1 1 300 2.0E-78
sp|Q2TZB2|SIDA_ASPOR L-ornithine N(5)-monooxygenase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dffA PE=1 SV=2 1 296 3.0E-78
sp|G5EB76|SIDA_EMENI L-ornithine N(5)-monooxygenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sidA PE=3 SV=1 1 296 1.0E-74
sp|Q51548|PVDA_PSEAE L-ornithine N(5)-monooxygenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pvdA PE=1 SV=2 11 300 7.0E-34
sp|O51940|PVDA_BURCE L-ornithine N(5)-monooxygenase OS=Burkholderia cepacia GN=pvdA PE=3 SV=1 11 297 7.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|E9QYP0|SIDA_ASPFU L-ornithine N(5)-monooxygenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sidA PE=1 SV=1 1 300 2.0E-78
sp|Q2TZB2|SIDA_ASPOR L-ornithine N(5)-monooxygenase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dffA PE=1 SV=2 1 296 3.0E-78
sp|G5EB76|SIDA_EMENI L-ornithine N(5)-monooxygenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sidA PE=3 SV=1 1 296 1.0E-74
sp|Q51548|PVDA_PSEAE L-ornithine N(5)-monooxygenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pvdA PE=1 SV=2 11 300 7.0E-34
sp|O51940|PVDA_BURCE L-ornithine N(5)-monooxygenase OS=Burkholderia cepacia GN=pvdA PE=3 SV=1 11 297 7.0E-31
sp|P56584|SIDA_USTMA L-ornithine N(5)-monooxygenase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID1 PE=1 SV=2 10 297 1.0E-24
sp|Q9P7T0|SIDA_SCHPO L-ornithine N(5)-monooxygenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib2 PE=3 SV=1 10 297 6.0E-24
sp|P11295|IUCD_ECOLX L-lysine N6-monooxygenase OS=Escherichia coli GN=iucD PE=1 SV=2 34 294 2.0E-11
sp|Q9Z3Q8|RHBE_RHIME Rhizobactin siderophore biosynthesis protein RhbE OS=Rhizobium meliloti (strain 1021) GN=rhbE PE=3 SV=1 12 299 2.0E-08
sp|P65199|ALCA_BORPE Alcaligin biosynthesis enzyme OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=alcA PE=3 SV=1 1 303 9.0E-07
sp|P65200|ALCA_BORPA Alcaligin biosynthesis enzyme OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=alcA PE=3 SV=1 1 303 9.0E-07
sp|Q44740|ALCA_BORBR Alcaligin biosynthesis enzyme OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=alcA PE=3 SV=2 1 303 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5054
LPKNFPLRHPRIIHSSEYAYRIRQMLPKASQPYRVAVVGAGQSAAEIFNNVQALYPNSKTWMIMRPEFLRPSDDS
PFVNSVFNPEYIDCLFPKSAKYRNSLLTEARATNYGVVRLNLIEELFERMYEQKRRLGADETQWPHRILGGRQIS
GIECRGEAMELRVRRAYDEGAADGFVDEAHDDEVLEADVVIAATGYQRNAHIHMLRDAWDMLPKSQPAGPDFGKG
ISGWKVDTDQGERKMAVGRDYRVKFAPGAVADGSGIYLQGCCEGTHGLSDTLLSVLATRSGEIVESIFGSQPGRA
EGK*
Coding >Hirsu2|5054
CTGCCCAAGAACTTCCCGCTGCGGCACCCGCGCATCATCCACTCGTCCGAGTACGCGTACCGGATCCGGCAGATG
CTGCCCAAGGCCAGCCAGCCGTACCGGGTCGCCGTCGTGGGCGCGGGCCAGAGCGCGGCCGAGATCTTCAACAAC
GTCCAGGCGCTGTACCCCAACTCCAAGACGTGGATGATCATGAGGCCCGAGTTCCTGCGGCCCAGCGACGACTCG
CCCTTCGTCAACTCCGTCTTCAACCCCGAGTACATCGACTGCCTGTTCCCCAAGTCGGCCAAGTACCGCAACAGC
CTGCTGACGGAGGCGCGGGCGACCAACTACGGCGTGGTGCGGCTGAACCTGATCGAGGAGCTGTTCGAGCGCATG
TACGAGCAGAAGCGGCGGCTGGGCGCGGACGAGACGCAGTGGCCGCACCGCATCCTCGGCGGGCGGCAGATCAGC
GGCATCGAGTGCCGGGGCGAGGCGATGGAGCTGCGGGTGCGGCGGGCGTACGACGAGGGCGCCGCCGACGGCTTC
GTCGACGAGGCCCACGACGACGAGGTGCTCGAGGCCGACGTCGTCATCGCCGCCACGGGCTACCAGCGCAACGCC
CACATCCACATGCTGCGCGACGCCTGGGACATGCTGCCCAAGTCGCAGCCGGCCGGGCCCGACTTCGGCAAGGGC
ATCTCCGGCTGGAAGGTCGACACGGACCAGGGCGAGCGCAAGATGGCCGTCGGCCGCGACTACAGGGTCAAGTTC
GCCCCGGGCGCCGTCGCCGACGGCTCCGGCATCTACCTGCAGGGCTGCTGCGAGGGCACACACGGGCTGAGCGAC
ACTCTTCTGTCGGTCCTCGCCACGAGGTCGGGCGAGATCGTCGAGTCCATCTTCGGCAGCCAGCCGGGCAGAGCC
GAGGGCAAGTGA
Transcript >Hirsu2|5054
CTGCCCAAGAACTTCCCGCTGCGGCACCCGCGCATCATCCACTCGTCCGAGTACGCGTACCGGATCCGGCAGATG
CTGCCCAAGGCCAGCCAGCCGTACCGGGTCGCCGTCGTGGGCGCGGGCCAGAGCGCGGCCGAGATCTTCAACAAC
GTCCAGGCGCTGTACCCCAACTCCAAGACGTGGATGATCATGAGGCCCGAGTTCCTGCGGCCCAGCGACGACTCG
CCCTTCGTCAACTCCGTCTTCAACCCCGAGTACATCGACTGCCTGTTCCCCAAGTCGGCCAAGTACCGCAACAGC
CTGCTGACGGAGGCGCGGGCGACCAACTACGGCGTGGTGCGGCTGAACCTGATCGAGGAGCTGTTCGAGCGCATG
TACGAGCAGAAGCGGCGGCTGGGCGCGGACGAGACGCAGTGGCCGCACCGCATCCTCGGCGGGCGGCAGATCAGC
GGCATCGAGTGCCGGGGCGAGGCGATGGAGCTGCGGGTGCGGCGGGCGTACGACGAGGGCGCCGCCGACGGCTTC
GTCGACGAGGCCCACGACGACGAGGTGCTCGAGGCCGACGTCGTCATCGCCGCCACGGGCTACCAGCGCAACGCC
CACATCCACATGCTGCGCGACGCCTGGGACATGCTGCCCAAGTCGCAGCCGGCCGGGCCCGACTTCGGCAAGGGC
ATCTCCGGCTGGAAGGTCGACACGGACCAGGGCGAGCGCAAGATGGCCGTCGGCCGCGACTACAGGGTCAAGTTC
GCCCCGGGCGCCGTCGCCGACGGCTCCGGCATCTACCTGCAGGGCTGCTGCGAGGGCACACACGGGCTGAGCGAC
ACTCTTCTGTCGGTCCTCGCCACGAGGTCGGGCGAGATCGTCGAGTCCATCTTCGGCAGCCAGCCGGGCAGAGCC
GAGGGCAAGTGA
Gene >Hirsu2|5054
CTGCCCAAGAACTTCCCGCTGCGGCACCCGCGCATCATCCACTCGTCCGAGTACGCGTACCGGATCCGGCAGATG
CTGCCCAAGGCCAGCCAGCCGTACCGGGTCGCCGTCGTGGGCGCGGGCCAGAGCGCGGCCGAGATCTTCAACAAC
GTCCAGGCGCTGTACCCCAACTCCAAGACGTGGATGATCATGAGGCCCGAGTTCCTGCGGCCCAGCGACGACTCG
CCCTTGTAAGTGCCAGCCCCCGGACGAGGGGACGGATACAAAGGAGGGCAGGACGCCGAGACTGACCACTCGCCG
GCCCGCAGCGTCAACTCCGTCTTCAACCCCGAGTACATCGACTGCCTGTTCCCCAAGTCGGCCAAGTACCGCAAC
AGCCTGCTGACGGAGGCGCGGGCGACCAACTACGGCGTGGTGCGGCTGAACCTGATCGAGGAGCTGTTCGAGCGC
ATGTACGAGCAGAAGCGGCGGCTGGGCGCGGACGAGACGCAGTGGCCGCACCGCATCCTCGGCGGGCGGCAGATC
AGCGGCATCGAGTGCCGGGGCGAGGCGATGGAGCTGCGGGTGCGGCGGGCGTACGACGAGGGCGCCGCCGACGGC
TTCGTCGACGAGGCCCACGACGACGAGGTGCTCGAGGCCGACGTCGTCATCGCCGCCACGGGCTACCAGCGCAAC
GCCCACATCCACATGCTGCGCGACGCCTGGGACATGCTGCCCAAGTCGCAGCCGGCCGGGCCCGACTTCGGCAAG
GGCATCTCCGGCTGGAAGGTCGACACGGACCAGGGCGAGCGCAAGATGGCCGTCGGCCGCGACTACAGGGTCAAG
TTCGCCCCGGGCGCCGTCGCCGACGGCTCCGGCATCTACCTGCAGGGCTGCTGCGAGGGCACACACGGGGTAAGC
TCTCTGCTTCTCCCCTCGGCCTGTATGGAGGAAGTGAGAGAGACGGAGGGAGGGCTTCGATCGTTGGCTAACACG
CAATGGCCGCAGCTGAGCGACACTCTTCTGTCGGTCCTCGCCACGAGGTCGGGCGAGATCGTCGAGTCCATCTTC
GGCAGCCAGCCGGGCAGAGCCGAGGGCAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail