Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5049
Gene name
LocationContig_2531:814..2389
Strand+
Gene length (bp)1575
Transcript length (bp)1446
Coding sequence length (bp)1446
Protein length (aa) 482

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02190 LON_substr_bdg ATP-dependent protease La (LON) substrate-binding domain 6.5E-17 313 424
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 1.0E-11 223 260
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 2.4E-07 223 260
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 6.4E-08 221 263
PF13445 zf-RING_UBOX RING-type zinc-finger 1.8E-07 223 258
PF13639 zf-RING_2 Ring finger domain 6.3E-07 222 261

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q17RB8|LONF1_HUMAN LON peptidase N-terminal domain and RING finger protein 1 OS=Homo sapiens GN=LONRF1 PE=1 SV=2 219 427 3.0E-44
sp|Q8HXH0|LONF3_MACFA LON peptidase N-terminal domain and RING finger protein 3 OS=Macaca fascicularis GN=LONRF3 PE=2 SV=1 202 427 6.0E-42
sp|Q496Y0|LONF3_HUMAN LON peptidase N-terminal domain and RING finger protein 3 OS=Homo sapiens GN=LONRF3 PE=1 SV=1 202 427 9.0E-42
sp|Q9D4H7|LONF3_MOUSE LON peptidase N-terminal domain and RING finger protein 3 OS=Mus musculus GN=Lonrf3 PE=2 SV=1 219 427 3.0E-41
sp|Q1L5Z9|LONF2_HUMAN LON peptidase N-terminal domain and RING finger protein 2 OS=Homo sapiens GN=LONRF2 PE=2 SV=3 198 429 6.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q17RB8|LONF1_HUMAN LON peptidase N-terminal domain and RING finger protein 1 OS=Homo sapiens GN=LONRF1 PE=1 SV=2 219 427 3.0E-44
sp|Q8HXH0|LONF3_MACFA LON peptidase N-terminal domain and RING finger protein 3 OS=Macaca fascicularis GN=LONRF3 PE=2 SV=1 202 427 6.0E-42
sp|Q496Y0|LONF3_HUMAN LON peptidase N-terminal domain and RING finger protein 3 OS=Homo sapiens GN=LONRF3 PE=1 SV=1 202 427 9.0E-42
sp|Q9D4H7|LONF3_MOUSE LON peptidase N-terminal domain and RING finger protein 3 OS=Mus musculus GN=Lonrf3 PE=2 SV=1 219 427 3.0E-41
sp|Q1L5Z9|LONF2_HUMAN LON peptidase N-terminal domain and RING finger protein 2 OS=Homo sapiens GN=LONRF2 PE=2 SV=3 198 429 6.0E-40
sp|O60106|YOXA_SCHPO LON peptidase N-terminal domain and RING finger protein C14F5.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC14F5.10c PE=3 SV=1 45 399 1.0E-37
sp|Q9P3U8|YJ95_SCHPO Uncharacterized RING finger protein C548.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC548.05c PE=3 SV=1 205 268 6.0E-09
sp|Q7T308|RN168_DANRE E3 ubiquitin-protein ligase RNF168 OS=Danio rerio GN=rnf168 PE=2 SV=1 196 265 5.0E-08
sp|O64425|RMA1_ARATH E3 ubiquitin-protein ligase RMA1 OS=Arabidopsis thaliana GN=RMA1 PE=1 SV=1 219 279 6.0E-07
sp|Q0IIM1|RN168_BOVIN E3 ubiquitin-protein ligase RNF168 OS=Bos taurus GN=RNF168 PE=2 SV=2 220 265 7.0E-07
sp|Q8GUK7|RMA3_ARATH E3 ubiquitin-protein ligase RMA3 OS=Arabidopsis thaliana GN=RMA3 PE=1 SV=1 222 270 4.0E-06
sp|O70263|LNX1_MOUSE E3 ubiquitin-protein ligase LNX OS=Mus musculus GN=Lnx1 PE=1 SV=1 200 310 6.0E-06
sp|Q8N448|LNX2_HUMAN Ligand of Numb protein X 2 OS=Homo sapiens GN=LNX2 PE=1 SV=1 218 285 1.0E-05
sp|Q91XL2|LNX2_MOUSE Ligand of Numb protein X 2 OS=Mus musculus GN=Lnx2 PE=1 SV=2 218 285 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5049
MDDARRHRCRSIRRRAPIIINTINAINSNNSRHRRSSARDIVRLFQCRQCSTPYKDAVTLPCGRSICRLCLPATH
IRTSITYPALPNRLQAFQCPFQECGKEHVLDDCGVDVVLNKVASIVRAEMERRAAQAVELSQSTSISVRDAWDVA
GIGSLVDRDTRPRIVRGTRLVATWTLAADGGLGFEAEVAYLGFASPPLRGSDGDPDAQSLGMLQEVMRSEVDCQV
CYAILYDPLTTGCGHTFCRPCLHRILDHSRYCPVCRRKLAINPLLKRSACPSNERIGKIMETFWKDELVTRHEAV
AAERAARHQDLDIPLFVCTLSFPMMPTFLHIFEPRYRLMIRRALEGDRTFGMVLPRRPRHGGDSHFHELGTLLRI
VNAQFYPDGRSLIETVGLSRFRVVRHGQLDGYTVGKTERIDDVSLEEEEAMEAAEVGYDAGDSAAGHRDARDGTD
DPGEATDAAKMDDDARGDAHGDARDGRWASR*
Coding >Hirsu2|5049
ATGGACGACGCCCGTCGCCACCGCTGCCGCAGCATCAGGCGCAGAGCTCCCATCATAATCAACACCATCAACGCC
ATCAACAGCAACAACAGCCGCCACCGCCGGTCCAGCGCCCGCGACATCGTCCGCCTCTTCCAGTGCCGCCAGTGC
TCGACTCCCTACAAAGACGCCGTCACCCTACCCTGCGGCCGCAGCATCTGCAGGCTGTGTCTGCCGGCAACGCAC
ATCCGAACCAGCATCACCTACCCGGCGCTGCCGAACCGCCTGCAGGCCTTCCAGTGTCCCTTCCAGGAGTGCGGC
AAGGAGCACGTGCTCGACGACTGCGGCGTCGACGTCGTCCTCAACAAGGTGGCCAGCATCGTGCGGGCCGAGATG
GAGCGCCGCGCTGCCCAGGCCGTCGAGCTGAGCCAGTCGACGTCCATCTCCGTCAGGGATGCCTGGGACGTGGCC
GGCATCGGGTCCCTCGTGGACCGGGACACGCGACCCCGGATCGTGCGCGGCACGCGGCTGGTGGCGACGTGGACG
CTGGCCGCCGACGGAGGACTCGGCTTTGAGGCCGAGGTCGCCTATCTCGGCTTTGCCTCGCCCCCTCTCCGCGGG
TCCGACGGGGACCCCGACGCACAGTCTCTCGGGATGCTGCAGGAGGTGATGCGCTCCGAGGTGGACTGCCAGGTC
TGCTATGCCATCCTCTACGACCCGCTGACGACGGGCTGCGGCCACACCTTCTGTCGCCCCTGTCTGCATCGCATC
CTCGACCACTCGCGCTACTGTCCCGTCTGCCGCCGCAAGCTTGCCATCAACCCCCTGCTCAAGCGCAGCGCCTGC
CCTTCCAACGAGCGCATCGGCAAGATCATGGAGACGTTCTGGAAGGACGAGCTCGTCACCCGGCACGAGGCCGTC
GCTGCCGAACGCGCCGCCCGCCACCAGGACCTCGACATTCCCCTCTTCGTCTGTACCCTGTCCTTCCCCATGATG
CCCACCTTCTTGCACATATTCGAGCCGCGCTACCGGCTCATGATCCGTCGGGCGCTCGAGGGGGACAGGACGTTT
GGCATGGTCCTGCCCAGGCGGCCCCGTCACGGGGGCGACTCGCACTTTCACGAGCTCGGCACCCTGCTCCGCATC
GTCAACGCGCAGTTCTACCCCGACGGCCGCAGCCTCATCGAGACGGTCGGCCTGTCCCGCTTCCGCGTCGTGCGC
CACGGGCAGCTGGACGGCTACACCGTCGGCAAGACGGAGAGGATCGACGACGTCAGCCTGGAGGAGGAGGAGGCC
ATGGAGGCCGCCGAGGTGGGCTACGACGCAGGGGACAGCGCGGCGGGCCACCGCGACGCCCGCGACGGCACCGAC
GACCCTGGCGAGGCCACCGACGCGGCCAAGATGGATGACGACGCGCGCGGCGACGCGCACGGCGACGCGCGCGAC
GGCCGGTGGGCGAGCAGGTAG
Transcript >Hirsu2|5049
ATGGACGACGCCCGTCGCCACCGCTGCCGCAGCATCAGGCGCAGAGCTCCCATCATAATCAACACCATCAACGCC
ATCAACAGCAACAACAGCCGCCACCGCCGGTCCAGCGCCCGCGACATCGTCCGCCTCTTCCAGTGCCGCCAGTGC
TCGACTCCCTACAAAGACGCCGTCACCCTACCCTGCGGCCGCAGCATCTGCAGGCTGTGTCTGCCGGCAACGCAC
ATCCGAACCAGCATCACCTACCCGGCGCTGCCGAACCGCCTGCAGGCCTTCCAGTGTCCCTTCCAGGAGTGCGGC
AAGGAGCACGTGCTCGACGACTGCGGCGTCGACGTCGTCCTCAACAAGGTGGCCAGCATCGTGCGGGCCGAGATG
GAGCGCCGCGCTGCCCAGGCCGTCGAGCTGAGCCAGTCGACGTCCATCTCCGTCAGGGATGCCTGGGACGTGGCC
GGCATCGGGTCCCTCGTGGACCGGGACACGCGACCCCGGATCGTGCGCGGCACGCGGCTGGTGGCGACGTGGACG
CTGGCCGCCGACGGAGGACTCGGCTTTGAGGCCGAGGTCGCCTATCTCGGCTTTGCCTCGCCCCCTCTCCGCGGG
TCCGACGGGGACCCCGACGCACAGTCTCTCGGGATGCTGCAGGAGGTGATGCGCTCCGAGGTGGACTGCCAGGTC
TGCTATGCCATCCTCTACGACCCGCTGACGACGGGCTGCGGCCACACCTTCTGTCGCCCCTGTCTGCATCGCATC
CTCGACCACTCGCGCTACTGTCCCGTCTGCCGCCGCAAGCTTGCCATCAACCCCCTGCTCAAGCGCAGCGCCTGC
CCTTCCAACGAGCGCATCGGCAAGATCATGGAGACGTTCTGGAAGGACGAGCTCGTCACCCGGCACGAGGCCGTC
GCTGCCGAACGCGCCGCCCGCCACCAGGACCTCGACATTCCCCTCTTCGTCTGTACCCTGTCCTTCCCCATGATG
CCCACCTTCTTGCACATATTCGAGCCGCGCTACCGGCTCATGATCCGTCGGGCGCTCGAGGGGGACAGGACGTTT
GGCATGGTCCTGCCCAGGCGGCCCCGTCACGGGGGCGACTCGCACTTTCACGAGCTCGGCACCCTGCTCCGCATC
GTCAACGCGCAGTTCTACCCCGACGGCCGCAGCCTCATCGAGACGGTCGGCCTGTCCCGCTTCCGCGTCGTGCGC
CACGGGCAGCTGGACGGCTACACCGTCGGCAAGACGGAGAGGATCGACGACGTCAGCCTGGAGGAGGAGGAGGCC
ATGGAGGCCGCCGAGGTGGGCTACGACGCAGGGGACAGCGCGGCGGGCCACCGCGACGCCCGCGACGGCACCGAC
GACCCTGGCGAGGCCACCGACGCGGCCAAGATGGATGACGACGCGCGCGGCGACGCGCACGGCGACGCGCGCGAC
GGCCGGTGGGCGAGCAGGTAG
Gene >Hirsu2|5049
ATGGACGACGCCCGTCGCCACCGCTGCCGCAGCATCAGGCGCAGAGCTCCCATCATAATCAACACCATCAACGCC
ATCAACAGCAACAACAGCCGCCACCGCCGGTCCAGCGTGGCTCCGCTGCTCCGCTAGACGGCCGGGGCCCTCACC
CGCATCAGGCCCGCGACATCGTCCGCCTCTTCCAGTGCCGCCAGTGCTCGACTCCCTACAAAGACGCCGTCACCC
TACCCTGCGGCCGCAGCATCTGCAGGCTGTGTCTGCCGGCAACGCACATCCGAACCAGCATCACCTACCCGGCGC
TGCCGAACCGCCTGCAGGCCTTCCAGTGTCCCTTCCAGGAGTGCGGCAAGGAGCACGTGCTCGACGACTGCGGCG
TCGACGTCGTCCTCAACAAGGTGGCCAGCATCGTGCGGGCCGAGATGGAGCGCCGCGCTGCCCAGGCCGTCGAGC
TGAGCCAGTCGACGTCCATCTCCGTCAGGGATGCCTGGGACGTGGCCGGCATCGGGTCCCTCGTGGACCGGGACA
CGCGACCCCGGATCGTGCGCGGCACGCGGCTGGTGGCGACGTGGACGCTGGCCGCCGACGGAGGACTCGGCTTTG
AGGCCGAGGTCGCCTATCTCGGCTTTGCCTCGCCCCCTCTCCGCGGGTCCGACGGGGACCCCGACGCACAGTCTC
TCGGGATGCTGCAGGAGGTGATGCGCTCCGAGGTGGACTGCCAGGTCTGCTATGCCATCCTCTACGACCCGCTGA
CGACGGGCTGCGGCCACACCTTCTGTCGCCCCTGTCTGCATCGCATCCTCGACCACTCGCGCTACTGTCCCGTCT
GCCGCCGCAAGCTTGCCATCAACCCCCTGCTCAAGCGCAGCGCCTGCCCTTCCAACGAGCGCATCGGCAAGATCA
TGGAGACGTTCTGGAAGGACGAGCTCGTCACCCGGCACGAGGCCGTCGCTGCCGAACGCGCCGCCCGCCACCAGG
ACCTCGACATTCCCCTCTTCGTCTGTACCCTGTCCTTCCCCATGATGCCCACCTTCTTGCACATATTCGAGCCGC
GCTACCGGCTCATGATCCGTCGGGCGCTCGAGGGGGACAGGACGTTTGGCATGGTCCTGCCCAGGCGGCCCCGTC
ACGGGGGCGACTCGCACTTTCACGAGCTCGGCACCCTGCTCCGCATCGTCAACGCGCAGTTCTACCCCGACGGCC
GCAGCCTCATCGAGACGGTCGGCCTGTCCCGCTTCCGCGTCGTGCGCCACGGGCAGCTGGACGGCTACACCGTCG
GCAAGACGGAGAGGATCGACGACGTCAGCCTGGAGGAGGAGGAGGCCATGGAGGCCGCCGAGGTGGGCTACGACG
CAGGGGACAGCGCGGCGGGCCACCGCGACGCCCGCGACGGCACCGACGACCCTGGCGAGGCCACCGACGCGGCCA
AGATGGATGACGACGCGCGCGGCGACGCGCACGGCGACGCGCGCGACGGCCGGGTACGCGACGGAGCGAAGGTAG
TGCGTCCCCGCGTGGGCCACGAGCGGGTGCTGCGCCGACCGGCGCGGCGACAGGTCGCAGTGGGCGAGCAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail