Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5048
Gene name
LocationContig_2530:514..2423
Strand+
Gene length (bp)1909
Transcript length (bp)1740
Coding sequence length (bp)1740
Protein length (aa) 580

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12253 CAF1A Chromatin assembly factor 1 subunit A 2.7E-21 359 434

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q1MTN9|RLF2_SCHPO Chromatin assembly factor 1 subunit rlf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rlf2 PE=3 SV=2 116 411 2.0E-21

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5048
MPLSPMDANIQETEAAGRKRSHTEFAEDSTATDGNAVDNASAPAPLPASQTQAHSSPQASPAMTDAGCSTPGLPA
SPSPQTPSKPAQPTPSNSGRQSTSPAASAPRSTATTQPVIKRKRLTAQEKEDRDKEAAEKKREREIQAAARAAEK
AKQEEEKAARAKEREEKRRKKEDEDRVKAEKKRKKEEEQRRAQEEKEKKERSQTKLNNFFSLPGTPKKPATGPSR
DSESPGGQSLADKTAKPTLSVYEKLFKPFYVRENTRWTASAAGLDEETREARSRALDDFISGRRVVEKRSAGFDA
VELLRLPGKTTKRGRQHHPVKHIMEKVYKQVQKLGDSSAAATGNALESARQRLAKVPIKIIAFSQDVRPPYYGTI
TYQPFALGMGNMYRAARRTSDRRLPLDYEYDSEAEWQEEEGEDVDVDDDEEEQDDEDDMDGFLDDSEDAGLSRPL
FANTMEPQSTGICFEGSPDSGSGRVLAEHSMEFVHDGLKRTCGIDPWSTQYWEPEPKRNATKNAKAAGGGGAVMA
PPPAPGSAFDAPASSSSGPEPKLVKAELLDDVKRLILANKELSKMSVIDIIFHQ*
Coding >Hirsu2|5048
ATGCCGCTCTCCCCGATGGACGCCAATATCCAGGAAACGGAGGCCGCCGGCCGGAAGCGGAGCCACACCGAGTTT
GCAGAGGATTCGACCGCCACGGACGGCAACGCTGTCGATAACGCATCTGCTCCAGCGCCTCTCCCCGCGAGCCAG
ACTCAAGCGCACTCGTCTCCCCAGGCCTCCCCGGCCATGACAGATGCCGGATGCAGCACCCCGGGACTGCCAGCC
TCTCCATCCCCACAAACTCCGTCAAAACCGGCGCAACCTACCCCGTCGAACAGCGGCCGGCAGTCCACTTCACCC
GCCGCTTCGGCGCCTCGGTCCACGGCCACAACTCAGCCAGTCATCAAACGCAAGCGACTGACCGCCCAAGAGAAA
GAGGATCGGGACAAGGAAGCGGCTGAGAAGAAGAGGGAGAGGGAGATCCAGGCGGCCGCTCGGGCGGCGGAAAAG
GCCAAGCAGGAAGAGGAGAAGGCTGCGCGGGCCAAGGAGCGGGAAGAAAAGCGCCGGAAGAAGGAAGACGAGGAC
CGGGTCAAGGCCGAGAAGAAGCGCAAGAAAGAGGAGGAGCAGCGGCGTGCCCAGGAAGAAAAGGAAAAGAAGGAA
CGATCGCAGACGAAGCTAAACAACTTCTTCAGCCTGCCCGGCACCCCAAAGAAACCGGCAACCGGGCCCAGCCGC
GATTCCGAGAGTCCGGGGGGCCAGTCCTTGGCGGACAAGACGGCCAAGCCGACGCTGTCGGTCTATGAAAAGCTC
TTCAAGCCATTCTATGTCCGAGAGAACACGCGATGGACGGCGTCTGCCGCCGGCCTGGACGAGGAAACACGCGAG
GCCAGGTCCCGTGCTCTCGACGACTTCATCAGCGGCCGCAGAGTAGTGGAGAAGAGGTCGGCGGGCTTTGATGCC
GTGGAATTGCTCCGCCTGCCCGGCAAGACGACGAAGAGGGGCCGGCAGCACCACCCGGTCAAGCACATCATGGAA
AAGGTCTACAAGCAGGTCCAGAAGCTGGGCGACAGCAGTGCAGCCGCGACCGGCAACGCCCTCGAGTCGGCCAGG
CAGAGGCTCGCAAAGGTGCCCATCAAGATCATTGCCTTCTCCCAGGACGTGCGGCCACCCTACTACGGCACCATC
ACCTACCAGCCCTTTGCCCTGGGCATGGGCAACATGTATCGCGCGGCACGCAGGACCAGTGACCGACGGCTGCCC
CTCGACTACGAGTATGATTCAGAGGCCGAGTGGCAGGAGGAGGAGGGCGAGGATGTCGACGTCGACGACGACGAG
GAAGAGCAGGATGACGAGGACGACATGGACGGCTTTCTCGACGACTCGGAGGATGCAGGGCTGTCGAGGCCGCTG
TTCGCAAACACGATGGAACCTCAGAGCACCGGCATCTGTTTCGAGGGCTCCCCGGACTCTGGCTCGGGTCGCGTG
CTTGCGGAGCATAGCATGGAGTTTGTGCATGACGGTCTCAAGCGCACCTGCGGCATCGACCCCTGGTCAACGCAG
TACTGGGAACCGGAGCCGAAGAGAAATGCGACGAAGAATGCAAAGGCCGCCGGAGGTGGTGGGGCCGTCATGGCG
CCACCCCCGGCTCCGGGAAGCGCTTTTGATGCTCCCGCGAGCTCTTCGTCCGGGCCGGAGCCGAAGCTGGTCAAG
GCCGAACTCTTGGACGACGTCAAGAGACTGATACTGGCGAACAAGGAGCTCTCGAAAATGAGCGTCATCGACATC
ATCTTCCACCAGTGA
Transcript >Hirsu2|5048
ATGCCGCTCTCCCCGATGGACGCCAATATCCAGGAAACGGAGGCCGCCGGCCGGAAGCGGAGCCACACCGAGTTT
GCAGAGGATTCGACCGCCACGGACGGCAACGCTGTCGATAACGCATCTGCTCCAGCGCCTCTCCCCGCGAGCCAG
ACTCAAGCGCACTCGTCTCCCCAGGCCTCCCCGGCCATGACAGATGCCGGATGCAGCACCCCGGGACTGCCAGCC
TCTCCATCCCCACAAACTCCGTCAAAACCGGCGCAACCTACCCCGTCGAACAGCGGCCGGCAGTCCACTTCACCC
GCCGCTTCGGCGCCTCGGTCCACGGCCACAACTCAGCCAGTCATCAAACGCAAGCGACTGACCGCCCAAGAGAAA
GAGGATCGGGACAAGGAAGCGGCTGAGAAGAAGAGGGAGAGGGAGATCCAGGCGGCCGCTCGGGCGGCGGAAAAG
GCCAAGCAGGAAGAGGAGAAGGCTGCGCGGGCCAAGGAGCGGGAAGAAAAGCGCCGGAAGAAGGAAGACGAGGAC
CGGGTCAAGGCCGAGAAGAAGCGCAAGAAAGAGGAGGAGCAGCGGCGTGCCCAGGAAGAAAAGGAAAAGAAGGAA
CGATCGCAGACGAAGCTAAACAACTTCTTCAGCCTGCCCGGCACCCCAAAGAAACCGGCAACCGGGCCCAGCCGC
GATTCCGAGAGTCCGGGGGGCCAGTCCTTGGCGGACAAGACGGCCAAGCCGACGCTGTCGGTCTATGAAAAGCTC
TTCAAGCCATTCTATGTCCGAGAGAACACGCGATGGACGGCGTCTGCCGCCGGCCTGGACGAGGAAACACGCGAG
GCCAGGTCCCGTGCTCTCGACGACTTCATCAGCGGCCGCAGAGTAGTGGAGAAGAGGTCGGCGGGCTTTGATGCC
GTGGAATTGCTCCGCCTGCCCGGCAAGACGACGAAGAGGGGCCGGCAGCACCACCCGGTCAAGCACATCATGGAA
AAGGTCTACAAGCAGGTCCAGAAGCTGGGCGACAGCAGTGCAGCCGCGACCGGCAACGCCCTCGAGTCGGCCAGG
CAGAGGCTCGCAAAGGTGCCCATCAAGATCATTGCCTTCTCCCAGGACGTGCGGCCACCCTACTACGGCACCATC
ACCTACCAGCCCTTTGCCCTGGGCATGGGCAACATGTATCGCGCGGCACGCAGGACCAGTGACCGACGGCTGCCC
CTCGACTACGAGTATGATTCAGAGGCCGAGTGGCAGGAGGAGGAGGGCGAGGATGTCGACGTCGACGACGACGAG
GAAGAGCAGGATGACGAGGACGACATGGACGGCTTTCTCGACGACTCGGAGGATGCAGGGCTGTCGAGGCCGCTG
TTCGCAAACACGATGGAACCTCAGAGCACCGGCATCTGTTTCGAGGGCTCCCCGGACTCTGGCTCGGGTCGCGTG
CTTGCGGAGCATAGCATGGAGTTTGTGCATGACGGTCTCAAGCGCACCTGCGGCATCGACCCCTGGTCAACGCAG
TACTGGGAACCGGAGCCGAAGAGAAATGCGACGAAGAATGCAAAGGCCGCCGGAGGTGGTGGGGCCGTCATGGCG
CCACCCCCGGCTCCGGGAAGCGCTTTTGATGCTCCCGCGAGCTCTTCGTCCGGGCCGGAGCCGAAGCTGGTCAAG
GCCGAACTCTTGGACGACGTCAAGAGACTGATACTGGCGAACAAGGAGCTCTCGAAAATGAGCGTCATCGACATC
ATCTTCCACCAGTGA
Gene >Hirsu2|5048
ATGCCGCTCTCCCCGATGGACGCCAATATCCAGGAAACGGAGGCCGCCGGCCGGAAGCGGAGCCACACCGAGTTT
GCAGAGGATTCGACCGCCACGGACGGCAACGCTGTCGATAACGCATCTGCTCCAGGTATCTTTTGCCCGACCGCC
TCCCTCTCTCATCGCCCGGAGCCGACCGTTCCAGCGCCTCTCCCCGCGAGCCAGACTCAAGCGCACTCGTCTCCC
CAGGCCTCCCCGGCCATGACAGATGCCGGATGCAGCACCCCGGGACTGCCAGCCTCTCCATCCCCACAAACTCCG
TCAAAACCGGCGCAACCTACCCCGTCGAACAGCGGCCGGCAGTCCACTTCACCCGCCGCTTCGGCGCCTCGGTCC
ACGGCCACAACTCAGCCAGTCATCAAACGCAAGCGACTGACCGCCCAAGAGAAAGAGGATCGGGACAAGGAAGCG
GCTGAGAAGAAGAGGGAGAGGGAGATCCAGGCGGCCGCTCGGGCGGCGGAAAAGGCCAAGCAGGAAGAGGAGAAG
GCTGCGCGGGCCAAGGAGCGGGAAGAAAAGCGCCGGAAGAAGGAAGACGAGGACCGGGTCAAGGCCGAGAAGAAG
CGCAAGAAAGAGGAGGAGCAGCGGCGTGCCCAGGAAGAAAAGGAAAAGAAGGAACGATCGCAGACGAAGCTAAAC
AACTTCTTCAGCCTGCCCGGCACCCCAAAGAAACCGGCAACCGGGCCCAGCCGCGATTCCGAGAGTCCGGGGGGC
CAGTCCTTGGCGGACAAGACGGCCAAGCCGACGCTGTCGGTCTATGAAAAGCTCTTCAAGCCATTCTATGTCCGA
GAGAACACGCGATGGACGGCGTCTGCCGCCGGCCTGGACGAGGAAACACGCGAGGCCAGGTCCCGTGCTCTCGAC
GACTTCATCAGCGGCCGCAGAGTAGTGGAGAAGAGGTCGGCGGGCTTTGATGCCGTGGAATTGCTCCGCCTGCCC
GGCAAGACGACGAAGAGGGGCCGGCAGCACCACCCGGTCAAGCACATCATGGAAAAGGTCTACAAGCAGGTCCAG
AAGCTGGGCGACAGCAGTGCAGCCGCGACCGGCAACGCCCTCGAGTCGGCCAGGCAGAGGCTCGCAAAGGTGCCC
ATCAAGATCATTGCCTTCTCCCAGGACGTGCGGCCACCCTACTACGGCACCATCACCTACCAGCCCTTTGCCCTG
GGCATGGGCAACATGTATCGCGCGGCACGCAGGACCAGTGACCGACGGCTGCCCCTCGACTACGAGTATGATTCA
GAGGCCGAGTGGCAGGAGGAGGAGGGCGAGGATGTCGACGTCGACGACGACGAGGAAGAGCAGGATGACGAGGAC
GACATGGACGGCTTTCTCGACGACTCGGAGGATGCAGGGCTGTCGAGGCCGCTGTTCGCAAACACGATGGAACCT
CAGAGCACCGGCATCTGTTTCGAGGGCTCCCCGGACTCTGGCTCGGGTCGCGTGCTTGCGGAGCATAGCATGGAG
TTTGTGCATGGTAGGCCCCCCCCCCCCCCCCCCCCCCTTCTCCTAACCGATGACTCGTCACTTACGGTCGACCCA
AAAGACGGTCTCAAGCGCACCTGCGGCATCGACCCCTGGTCAACGCAGTACTGGGAACCGGAGCCGAAGAGAAAT
GCGACGAAGAATGCAAAGGCCGCCGGAGGTGGTGGGGCCGTCATGGCGCCACCCCCGGCTCCGGGAAGCGCTTTT
GATGCTCCCGCGAGCTCTTCGTCCGGGCCGGAGCCGAAGCTGGTCAAGGCCGAACTCTTGGACGACGTCAAGAGA
CTGATACTGGCGAACAAGGAGCTCTCGAAAATGAGCGTCATCGACATCATCTTCCACCAGGTTCGAGAGAACGCC
TCGCGAGCCGAGGTGAAGCGGACGGTGGAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail