Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5047
Gene name
LocationContig_253:25627..27311
Strand+
Gene length (bp)1684
Transcript length (bp)1521
Coding sequence length (bp)1521
Protein length (aa) 507

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.5E-32 68 449

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 16 502 1.0E-115
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 34 502 3.0E-115
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 39 502 8.0E-114
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 39 502 9.0E-114
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 2 502 1.0E-100
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 16 502 1.0E-115
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 34 502 3.0E-115
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 39 502 8.0E-114
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 39 502 9.0E-114
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 2 502 1.0E-100
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 34 502 1.0E-96
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 10 502 2.0E-61
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 10 502 5.0E-61
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 40 502 1.0E-59
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 47 504 3.0E-57
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 20 502 1.0E-55
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 3 505 8.0E-52
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 43 500 5.0E-50
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 50 500 2.0E-49
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 54 503 2.0E-49
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 8 503 2.0E-48
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 36 501 3.0E-48
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 20 503 7.0E-48
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 45 504 8.0E-48
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 5 500 1.0E-45
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 44 500 4.0E-45
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 19 501 6.0E-42
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 12 502 2.0E-41
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 48 501 8.0E-41
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 48 501 3.0E-40
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 11 506 2.0E-39
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 51 502 1.0E-36
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 10 506 6.0E-24
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 23 274 9.0E-17
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 77 491 1.0E-13
sp|Q4UMJ9|BCRH_RICFE Uncharacterized transporter RF_0358 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0358 PE=3 SV=1 76 244 1.0E-10
sp|Q1RI77|BCRH_RICBR Uncharacterized transporter RBE_0856 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0856 PE=3 SV=1 66 243 3.0E-09
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 356 501 6.0E-08
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 84 269 4.0E-07
sp|Q68WD6|BCRH_RICTY Uncharacterized transporter RT0591 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0591 PE=3 SV=1 76 243 9.0E-07
sp|Q9ZCV6|BCRH_RICPR Uncharacterized transporter RP603 OS=Rickettsia prowazekii (strain Madrid E) GN=RP603 PE=3 SV=1 76 243 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 61 83 22
2 96 118 22
3 133 155 22
4 190 212 22
5 227 249 22
6 297 319 22
7 334 356 22
8 376 395 19
9 410 432 22
10 445 467 22
11 471 493 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5047
LPHEAPAFIQARLEADEAHELQKTTSVPIVPRRSKDGAILVDWYYSDDGDNPHNWSNGKRALVGAVICLYTFVVY
TSSAIYTSSIPGIMDRFGVSSLVATLGLSLYVLGYGIGPLLFSPLSEIPIIGRNPVYALTVFLFVVLSIPTAFAS
SFAGLMVLRFLQGFFGSPCLASGGASLGDMYSLMALPYAMVAWVSAAYCGPALGPLLSGFAVPAKSWRWSLYESI
WVSAPIFLLMLAILPETSSATILLRRARRLRRLTGNKRFMSQSEIDQRDMKFTSIALDALIKPIEITIKDPAVLF
VQVYTAIIYGIYYSFFEVFPLVYPVYYHMNLGQTGLVFLCILASCLFGIVLYCSYLYFYMQPRILRQGMPVQEMR
LVPALPAAFGPTVGLFLFAWTARASSHWIVPTIGITIYGATCFVVMQCIFVYVPLSYPQYAASLFAANDFFRSAL
ACGSVVFAHPLFGNLGVARGVSLLGGLSVVGIVGIWLLYFHGARLRALSKFALSGE*
Coding >Hirsu2|5047
CTGCCGCACGAGGCACCGGCCTTCATCCAGGCTCGGCTGGAGGCCGACGAGGCGCACGAGCTGCAAAAGACGACG
TCGGTGCCCATCGTCCCCCGGCGGTCCAAGGATGGGGCCATCCTGGTCGACTGGTACTACAGCGACGACGGCGAC
AACCCGCACAACTGGAGCAACGGCAAACGGGCGCTCGTCGGCGCCGTCATCTGCCTGTACACCTTTGTCGTTTAC
ACCTCGTCCGCCATCTACACCTCGTCCATCCCGGGCATCATGGACCGCTTCGGCGTCAGCTCCCTCGTCGCCACC
CTCGGCCTCTCCCTCTACGTCCTCGGCTACGGCATCGGGCCCCTGCTCTTCTCGCCCCTCAGCGAGATACCCATC
ATCGGCCGCAACCCCGTCTACGCCCTGACCGTGTTCCTCTTCGTCGTTCTCTCCATCCCGACCGCCTTCGCCTCC
AGCTTCGCCGGCCTCATGGTCCTGCGCTTCCTCCAGGGCTTCTTCGGCTCCCCCTGCCTGGCCTCGGGCGGCGCC
TCGCTCGGCGACATGTACAGCCTCATGGCCTTGCCCTACGCCATGGTGGCTTGGGTCTCGGCCGCCTACTGCGGT
CCCGCCCTCGGCCCTCTCCTCAGCGGCTTCGCCGTGCCCGCCAAGTCGTGGCGTTGGTCCCTGTACGAGTCCATC
TGGGTCTCGGCCCCCATCTTCCTCCTCATGCTCGCCATCCTGCCCGAGACGAGCAGCGCGACTATTCTCCTCCGC
CGCGCTCGCCGCCTCCGTCGCCTCACCGGCAACAAGCGGTTCATGTCGCAGAGCGAGATCGACCAGCGCGACATG
AAGTTCACCTCCATCGCCCTCGACGCCCTTATCAAGCCCATCGAGATCACCATCAAGGACCCGGCCGTCCTCTTC
GTCCAGGTCTACACCGCCATCATCTACGGCATCTATTACTCCTTCTTCGAAGTCTTCCCCCTCGTCTATCCCGTC
TACTACCACATGAACCTCGGCCAGACCGGCCTCGTCTTCCTCTGCATCCTCGCCTCGTGCCTCTTCGGCATCGTC
CTCTACTGCAGCTACCTCTACTTCTACATGCAGCCTCGCATCCTCCGGCAGGGGATGCCGGTCCAGGAGATGCGG
CTGGTGCCGGCCCTGCCCGCCGCCTTCGGCCCAACCGTCGGCCTCTTCCTCTTCGCCTGGACAGCCCGCGCCTCG
AGCCACTGGATCGTGCCGACCATCGGCATCACCATCTACGGCGCCACCTGCTTCGTCGTCATGCAGTGCATCTTC
GTCTACGTGCCGCTCAGCTACCCGCAGTACGCCGCCAGCCTCTTCGCCGCCAACGACTTCTTCCGCAGCGCCCTC
GCCTGCGGCAGCGTCGTCTTCGCCCACCCGCTCTTCGGCAACCTCGGCGTCGCCAGGGGCGTCAGTCTCCTCGGC
GGCCTCAGCGTCGTCGGCATCGTCGGCATCTGGCTGCTCTACTTTCATGGCGCCAGGCTCCGTGCCCTCAGCAAG
TTTGCCCTCTCCGGCGAATAA
Transcript >Hirsu2|5047
CTGCCGCACGAGGCACCGGCCTTCATCCAGGCTCGGCTGGAGGCCGACGAGGCGCACGAGCTGCAAAAGACGACG
TCGGTGCCCATCGTCCCCCGGCGGTCCAAGGATGGGGCCATCCTGGTCGACTGGTACTACAGCGACGACGGCGAC
AACCCGCACAACTGGAGCAACGGCAAACGGGCGCTCGTCGGCGCCGTCATCTGCCTGTACACCTTTGTCGTTTAC
ACCTCGTCCGCCATCTACACCTCGTCCATCCCGGGCATCATGGACCGCTTCGGCGTCAGCTCCCTCGTCGCCACC
CTCGGCCTCTCCCTCTACGTCCTCGGCTACGGCATCGGGCCCCTGCTCTTCTCGCCCCTCAGCGAGATACCCATC
ATCGGCCGCAACCCCGTCTACGCCCTGACCGTGTTCCTCTTCGTCGTTCTCTCCATCCCGACCGCCTTCGCCTCC
AGCTTCGCCGGCCTCATGGTCCTGCGCTTCCTCCAGGGCTTCTTCGGCTCCCCCTGCCTGGCCTCGGGCGGCGCC
TCGCTCGGCGACATGTACAGCCTCATGGCCTTGCCCTACGCCATGGTGGCTTGGGTCTCGGCCGCCTACTGCGGT
CCCGCCCTCGGCCCTCTCCTCAGCGGCTTCGCCGTGCCCGCCAAGTCGTGGCGTTGGTCCCTGTACGAGTCCATC
TGGGTCTCGGCCCCCATCTTCCTCCTCATGCTCGCCATCCTGCCCGAGACGAGCAGCGCGACTATTCTCCTCCGC
CGCGCTCGCCGCCTCCGTCGCCTCACCGGCAACAAGCGGTTCATGTCGCAGAGCGAGATCGACCAGCGCGACATG
AAGTTCACCTCCATCGCCCTCGACGCCCTTATCAAGCCCATCGAGATCACCATCAAGGACCCGGCCGTCCTCTTC
GTCCAGGTCTACACCGCCATCATCTACGGCATCTATTACTCCTTCTTCGAAGTCTTCCCCCTCGTCTATCCCGTC
TACTACCACATGAACCTCGGCCAGACCGGCCTCGTCTTCCTCTGCATCCTCGCCTCGTGCCTCTTCGGCATCGTC
CTCTACTGCAGCTACCTCTACTTCTACATGCAGCCTCGCATCCTCCGGCAGGGGATGCCGGTCCAGGAGATGCGG
CTGGTGCCGGCCCTGCCCGCCGCCTTCGGCCCAACCGTCGGCCTCTTCCTCTTCGCCTGGACAGCCCGCGCCTCG
AGCCACTGGATCGTGCCGACCATCGGCATCACCATCTACGGCGCCACCTGCTTCGTCGTCATGCAGTGCATCTTC
GTCTACGTGCCGCTCAGCTACCCGCAGTACGCCGCCAGCCTCTTCGCCGCCAACGACTTCTTCCGCAGCGCCCTC
GCCTGCGGCAGCGTCGTCTTCGCCCACCCGCTCTTCGGCAACCTCGGCGTCGCCAGGGGCGTCAGTCTCCTCGGC
GGCCTCAGCGTCGTCGGCATCGTCGGCATCTGGCTGCTCTACTTTCATGGCGCCAGGCTCCGTGCCCTCAGCAAG
TTTGCCCTCTCCGGCGAATAA
Gene >Hirsu2|5047
CTGCCGCACGAGGCACCGGCCTTCATCCAGGCTCGGCTGGAGGCCGACGAGGCGCACGAGCTGCAAAAGACGACG
TCGGTGCCCATCGTCCCCCGGCGGTCCAAGGATGGGGCCATCCTGGTCGACTGGTACTACAGCGACGACGGCGAC
AACCCGCACAACTGGAGCAACGGCAAACGGGCGCTCGTCGGCGCCGTCATCTGCCTGTACACCTTTGTCGTTTAC
ACCTCGTCCGCCATCTACACCTCGTCCATCCCGGGCATCATGGACCGCTTCGGCGTCAGCTCCCTCGTCGCCACC
CTCGGCCTCTCCCTCTACGTCCTCGGCTACGGCATCGGGCCCCTGCTCTTCTCGCCCCTCAGCGAGATACCCATC
ATCGGCCGCAACCCCGTCTACGCCCTGACCGTGTTCCTCTTCGTCGTTCTCTCCATCCCGACCGCCTTCGCCTCC
AGCTTCGCCGGCCTCATGGTCCTGCGCTTCCTCCAGGGCTTCTTCGGCTCCCCCTGCCTGGCCTCGGGCGGCGCC
TCGCTCGGCGACATGTACAGCCTCATGGCCTTGCCCTACGCCATGGTGGCTTGGGTCTCGGCCGCCTACTGCGGT
CGTACGTCCTGTCCAGTCTTGTCTCCCCCCTCCCTCGCTGCCTCACGGCTGACTGACAGCAGGTCGATGGCGACA
GCCGCCCTCGGCCCTCTCCTCAGCGGCTTCGCCGTGCCCGCCAAGTCGTGGCGTTGGTCCCTGTACGAGTCCATC
TGGGTCTCGGCCCCCATCTTCCTCCTCATGCTCGCCATCCTGCCCGAGACGAGCAGCGCGACTATTCTCCTCCGC
CGCGCTCGCCGCCTCCGTCGCCTCACCGGCAACAAGCGGTTCATGTCGCAGAGCGAGATCGACCAGCGCGACATG
AAGTTCACCTCCATCGCCCTCGACGCCCTTATCAAGCCCATCGAGATCACCATCAAGGACCCGGCCGTCCTCTTC
GTCCAGGTCTACACCGCCATCATCTACGGCATCTATTACTCCTGTGTGTATCCCTCCACCCACCCCCAAACGAGA
CGGAGCGGCGAGGGAAGGGGGGGCAAAAGGAGAAGAATCTAACCGGCATCCAAAAGTCTTCGAAGTCTTCCCCCT
CGTCTATCCCGTCTACTACCACATGAACCTCGGCCAGACCGGCCTCGTCTTCCTCTGCATCCTCGCCTCGTGCCT
CTTCGGCATCGTCCTCTACTGCAGCTACCTCTACTTCTACATGCAGCCTCGCATCCTCCGGCAGGGGATGCCGGT
CCAGGAGATGCGGCTGGTGCCGGCCCTGCCCGCCGCCTTCGGCCCAACCGTCGGCCTCTTCCTCTTCGCCTGGAC
AGCCCGCGCCTCGAGCCACTGGATCGTGCCGACCATCGGCATCACCATCTACGGCGCCACCTGCTTCGTCGTCAT
GCAGTGCATCTTCGTCTACGTGCCGCTCAGCTACCCGCAGTACGCCGCCAGCCTCTTCGCCGCCAACGACTTCTT
CCGCAGCGCCCTCGCCTGCGGCAGCGTCGTCTTCGCCCACCCGCTCTTCGGCAACCTCGGCGTCGCCAGGGGCGT
CAGTCTCCTCGGCGGCCTCAGCGTCGTCGGCATCGTCGGCATCTGGCTGCTCTACTTTCATGGCGCCAGGCTCCG
TGCCCTCAGCAAGTTTGCCCTCTCCGGCGAATAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail