Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5044
Gene name
LocationContig_253:14841..20548
Strand+
Gene length (bp)5707
Transcript length (bp)5589
Coding sequence length (bp)5589
Protein length (aa) 1863

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18314 FAS_I_H Fatty acid synthase type I helical domain 2.1E-77 330 531
PF18325 Fas_alpha_ACP Fatty acid synthase subunit alpha Acyl carrier domain 7.1E-74 142 303
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 5.4E-21 1146 1363
PF01648 ACPS 4'-phosphopantetheinyl transferase superfamily 1.3E-18 1744 1844
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 3.9E-11 1495 1585

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78615|FAS2_EMEND Fatty acid synthase subunit alpha OS=Emericella nidulans GN=fasA PE=3 SV=1 1 1862 0.0E+00
sp|P15368|FAS2_PENPA Fatty acid synthase subunit alpha OS=Penicillium patulum GN=FAS2 PE=3 SV=1 1 1862 0.0E+00
sp|P43098|FAS2_CANAX Fatty acid synthase subunit alpha OS=Candida albicans GN=FAS2 PE=3 SV=1 1 1862 0.0E+00
sp|Q10289|FAS2_SCHPO Fatty acid synthase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fas2 PE=1 SV=2 1 1861 0.0E+00
sp|G8BAW7|FAS2_CANPC Fatty acid synthase subunit alpha OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) GN=FAS2 PE=2 SV=1 1 1862 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78615|FAS2_EMEND Fatty acid synthase subunit alpha OS=Emericella nidulans GN=fasA PE=3 SV=1 1 1862 0.0E+00
sp|P15368|FAS2_PENPA Fatty acid synthase subunit alpha OS=Penicillium patulum GN=FAS2 PE=3 SV=1 1 1862 0.0E+00
sp|P43098|FAS2_CANAX Fatty acid synthase subunit alpha OS=Candida albicans GN=FAS2 PE=3 SV=1 1 1862 0.0E+00
sp|Q10289|FAS2_SCHPO Fatty acid synthase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fas2 PE=1 SV=2 1 1861 0.0E+00
sp|G8BAW7|FAS2_CANPC Fatty acid synthase subunit alpha OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) GN=FAS2 PE=2 SV=1 1 1862 0.0E+00
sp|Q765N2|FAS2_LACKL Fatty acid synthase subunit alpha OS=Lachancea kluyveri GN=FAS2 PE=3 SV=1 1 1860 0.0E+00
sp|P19097|FAS2_YEAST Fatty acid synthase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAS2 PE=1 SV=2 1 1860 0.0E+00
sp|Q5B7V0|FAS2_EMENI Fatty acid synthase subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fasA PE=2 SV=1 611 1860 0.0E+00
sp|Q00681|STCJ_EMENI Sterigmatocystin biosynthesis fatty acid synthase subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcJ PE=3 SV=2 627 1412 0.0E+00
sp|Q00681|STCJ_EMENI Sterigmatocystin biosynthesis fatty acid synthase subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcJ PE=3 SV=2 1494 1859 2.0E-82
sp|Q5B7V0|FAS2_EMENI Fatty acid synthase subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fasA PE=2 SV=1 10 530 3.0E-66
sp|Q00681|STCJ_EMENI Sterigmatocystin biosynthesis fatty acid synthase subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcJ PE=3 SV=2 111 517 8.0E-36
sp|A5US51|ACPS_ROSS1 Holo-[acyl-carrier-protein] synthase OS=Roseiflexus sp. (strain RS-1) GN=acpS PE=3 SV=1 1746 1861 1.0E-16
sp|Q2LTJ7|ACPS_SYNAS Holo-[acyl-carrier-protein] synthase OS=Syntrophus aciditrophicus (strain SB) GN=acpS PE=3 SV=1 1747 1859 2.0E-15
sp|Q8R857|ACPS_CALS4 Holo-[acyl-carrier-protein] synthase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=acpS PE=3 SV=1 1747 1860 2.0E-15
sp|B0K5Y6|ACPS_THEPX Holo-[acyl-carrier-protein] synthase OS=Thermoanaerobacter sp. (strain X514) GN=acpS PE=3 SV=1 1747 1860 2.0E-15
sp|B0KD52|ACPS_THEP3 Holo-[acyl-carrier-protein] synthase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=acpS PE=3 SV=1 1747 1860 2.0E-15
sp|Q97LR5|ACPS_CLOAB Holo-[acyl-carrier-protein] synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=acpS PE=3 SV=1 1745 1859 1.0E-14
sp|Q7UQA5|ACPS_RHOBA Holo-[acyl-carrier-protein] synthase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=acpS PE=3 SV=1 1760 1859 2.0E-14
sp|B9MKY6|ACPS_CALBD Holo-[acyl-carrier-protein] synthase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=acpS PE=3 SV=1 1745 1860 3.0E-14
sp|B9M2U0|ACPS_GEODF Holo-[acyl-carrier-protein] synthase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=acpS PE=3 SV=1 1746 1859 4.0E-14
sp|Q2RGI1|ACPS_MOOTA Holo-[acyl-carrier-protein] synthase OS=Moorella thermoacetica (strain ATCC 39073) GN=acpS PE=3 SV=1 1746 1859 4.0E-14
sp|B2A4X6|ACPS_NATTJ Holo-[acyl-carrier-protein] synthase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=acpS PE=3 SV=1 1745 1859 8.0E-14
sp|B2TQY6|ACPS_CLOBB Holo-[acyl-carrier-protein] synthase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=acpS PE=3 SV=1 1747 1859 1.0E-13
sp|A7NPN5|ACPS_ROSCS Holo-[acyl-carrier-protein] synthase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=acpS PE=3 SV=1 1746 1860 2.0E-13
sp|Q7NE72|ACPS_GLOVI Holo-[acyl-carrier-protein] synthase OS=Gloeobacter violaceus (strain PCC 7421) GN=acpS PE=3 SV=1 1744 1862 8.0E-13
sp|B2V003|ACPS_CLOBA Holo-[acyl-carrier-protein] synthase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=acpS PE=3 SV=1 1747 1859 8.0E-13
sp|Q01RT7|ACPS_SOLUE Holo-[acyl-carrier-protein] synthase OS=Solibacter usitatus (strain Ellin6076) GN=acpS PE=3 SV=1 1746 1856 1.0E-12
sp|B8G840|ACPS_CHLAD Holo-[acyl-carrier-protein] synthase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=acpS PE=3 SV=1 1746 1860 1.0E-12
sp|A0L8S4|ACPS_MAGMM Holo-[acyl-carrier-protein] synthase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=acpS PE=3 SV=1 1762 1859 2.0E-12
sp|A5N379|ACPS_CLOK5 Holo-[acyl-carrier-protein] synthase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=acpS PE=3 SV=1 1745 1859 2.0E-12
sp|B1I1U5|ACPS_DESAP Holo-[acyl-carrier-protein] synthase OS=Desulforudis audaxviator (strain MP104C) GN=acpS PE=3 SV=1 1745 1860 2.0E-12
sp|A4J8G9|ACPS_DESRM Holo-[acyl-carrier-protein] synthase OS=Desulfotomaculum reducens (strain MI-1) GN=acpS PE=3 SV=1 1745 1860 2.0E-12
sp|Q8KB56|ACPS_CHLTE Holo-[acyl-carrier-protein] synthase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=acpS PE=3 SV=1 1745 1859 3.0E-12
sp|Q0SW89|ACPS_CLOPS Holo-[acyl-carrier-protein] synthase OS=Clostridium perfringens (strain SM101 / Type A) GN=acpS PE=3 SV=1 1745 1859 4.0E-12
sp|A4XIB7|ACPS_CALS8 Holo-[acyl-carrier-protein] synthase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=acpS PE=3 SV=1 1745 1860 5.0E-12
sp|Q8XNP1|ACPS_CLOPE Holo-[acyl-carrier-protein] synthase OS=Clostridium perfringens (strain 13 / Type A) GN=acpS PE=3 SV=1 1745 1859 5.0E-12
sp|Q0TUE3|ACPS_CLOP1 Holo-[acyl-carrier-protein] synthase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=acpS PE=3 SV=1 1745 1859 6.0E-12
sp|B0SM94|ACPS_LEPBP Holo-[acyl-carrier-protein] synthase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=acpS PE=3 SV=1 1760 1859 7.0E-12
sp|B0SE17|ACPS_LEPBA Holo-[acyl-carrier-protein] synthase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=acpS PE=3 SV=1 1760 1859 7.0E-12
sp|B8D0V9|ACPS_HALOH Holo-[acyl-carrier-protein] synthase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=acpS PE=3 SV=1 1745 1860 8.0E-12
sp|Q9Z8M5|ACPS_CHLPN Holo-[acyl-carrier-protein] synthase OS=Chlamydia pneumoniae GN=acpS PE=3 SV=1 1745 1860 2.0E-11
sp|A8MJ27|ACPS_ALKOO Holo-[acyl-carrier-protein] synthase OS=Alkaliphilus oremlandii (strain OhILAs) GN=acpS PE=3 SV=1 1759 1860 3.0E-11
sp|Q254H8|ACPS_CHLFF Holo-[acyl-carrier-protein] synthase OS=Chlamydophila felis (strain Fe/C-56) GN=acpS PE=3 SV=1 1743 1860 3.0E-11
sp|B8I3U1|ACPS_CLOCE Holo-[acyl-carrier-protein] synthase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=acpS PE=3 SV=1 1745 1859 4.0E-11
sp|Q74C71|ACPS_GEOSL Holo-[acyl-carrier-protein] synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=acpS PE=3 SV=1 1746 1859 4.0E-11
sp|A0PY92|ACPS_CLONN Holo-[acyl-carrier-protein] synthase OS=Clostridium novyi (strain NT) GN=acpS PE=3 SV=1 1745 1859 6.0E-11
sp|Q890W8|ACPS_CLOTE Holo-[acyl-carrier-protein] synthase OS=Clostridium tetani (strain Massachusetts / E88) GN=acpS PE=3 SV=1 1759 1859 7.0E-11
sp|Q820E7|ACPS_CHLCV Holo-[acyl-carrier-protein] synthase OS=Chlamydophila caviae (strain GPIC) GN=acpS PE=3 SV=1 1741 1859 7.0E-11
sp|A6M302|ACPS_CLOB8 Holo-[acyl-carrier-protein] synthase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=acpS PE=3 SV=1 1745 1859 1.0E-10
sp|B5EI15|ACPS_GEOBB Holo-[acyl-carrier-protein] synthase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=acpS PE=3 SV=1 1746 1859 1.0E-10
sp|A4SCZ9|ACPS_CHLPM Holo-[acyl-carrier-protein] synthase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=acpS PE=3 SV=1 1745 1862 1.0E-10
sp|Q9HU15|FABY_PSEAE Beta-ketoacyl-[acyl-carrier-protein] synthase FabY OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fabY PE=1 SV=1 1051 1402 2.0E-10
sp|C6E2U2|ACPS_GEOSM Holo-[acyl-carrier-protein] synthase OS=Geobacter sp. (strain M21) GN=acpS PE=3 SV=1 1746 1859 2.0E-10
sp|Q05356|KAS1_STRHA Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces halstedii GN=sch1 PE=3 SV=1 1165 1377 2.0E-10
sp|Q73LF7|ACPS_TREDE Holo-[acyl-carrier-protein] synthase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=acpS PE=3 SV=1 1745 1859 3.0E-10
sp|Q3Z9B0|ACPS_DEHM1 Holo-[acyl-carrier-protein] synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=acpS PE=3 SV=1 1746 1861 4.0E-10
sp|B0BB87|ACPS_CHLTB Holo-[acyl-carrier-protein] synthase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=acpS PE=3 SV=1 1759 1861 6.0E-10
sp|B0B9K8|ACPS_CHLT2 Holo-[acyl-carrier-protein] synthase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=acpS PE=3 SV=1 1759 1861 6.0E-10
sp|Q5L623|ACPS_CHLAB Holo-[acyl-carrier-protein] synthase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=acpS PE=3 SV=1 1743 1860 7.0E-10
sp|B9LIY4|ACPS_CHLSY Holo-[acyl-carrier-protein] synthase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=acpS PE=3 SV=1 1746 1860 8.0E-10
sp|A9WE63|ACPS_CHLAA Holo-[acyl-carrier-protein] synthase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=acpS PE=3 SV=1 1746 1860 8.0E-10
sp|Q02578|KAS1_STRCN Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cyaneus GN=curA PE=3 SV=1 1141 1373 1.0E-09
sp|A6TVL0|ACPS_ALKMQ Holo-[acyl-carrier-protein] synthase OS=Alkaliphilus metalliredigens (strain QYMF) GN=acpS PE=3 SV=1 1759 1860 2.0E-09
sp|Q1IHY2|ACPS_KORVE Holo-[acyl-carrier-protein] synthase OS=Koribacter versatilis (strain Ellin345) GN=acpS PE=3 SV=1 1746 1859 2.0E-09
sp|B3QR46|ACPS_CHLP8 Holo-[acyl-carrier-protein] synthase OS=Chlorobaculum parvum (strain NCIB 8327) GN=acpS PE=3 SV=1 1745 1859 2.0E-09
sp|Q67K77|ACPS_SYMTH Holo-[acyl-carrier-protein] synthase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=acpS PE=3 SV=1 1746 1859 2.0E-09
sp|Q3ZZK3|ACPS_DEHMC Holo-[acyl-carrier-protein] synthase OS=Dehalococcoides mccartyi (strain CBDB1) GN=acpS PE=3 SV=1 1746 1860 2.0E-09
sp|A5FS12|ACPS_DEHMB Holo-[acyl-carrier-protein] synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=acpS PE=3 SV=1 1746 1860 2.0E-09
sp|O84102|ACPS_CHLTR Holo-[acyl-carrier-protein] synthase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=acpS PE=3 SV=1 1759 1861 2.0E-09
sp|Q3KMS0|ACPS_CHLTA Holo-[acyl-carrier-protein] synthase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=acpS PE=3 SV=1 1759 1861 2.0E-09
sp|Q39UG1|ACPS_GEOMG Holo-[acyl-carrier-protein] synthase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=acpS PE=3 SV=1 1746 1859 5.0E-09
sp|B3QTH9|ACPS_CHLT3 Holo-[acyl-carrier-protein] synthase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=acpS PE=3 SV=1 1744 1859 8.0E-09
sp|B3EGP9|ACPS_CHLL2 Holo-[acyl-carrier-protein] synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=acpS PE=3 SV=1 1745 1862 2.0E-08
sp|Q31HN9|ACPS_THICR Holo-[acyl-carrier-protein] synthase OS=Thiomicrospira crunogena (strain XCL-2) GN=acpS PE=3 SV=1 1745 1861 2.0E-08
sp|Q3A5V3|ACPS_PELCD Holo-[acyl-carrier-protein] synthase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=acpS PE=3 SV=1 1763 1859 2.0E-08
sp|A5F5H4|ACPS_VIBC3 Holo-[acyl-carrier-protein] synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=acpS PE=3 SV=1 1745 1859 3.0E-08
sp|Q9PKT6|ACPS_CHLMU Holo-[acyl-carrier-protein] synthase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=acpS PE=3 SV=1 1745 1860 3.0E-08
sp|Q6MAG4|ACPS_PARUW Holo-[acyl-carrier-protein] synthase OS=Protochlamydia amoebophila (strain UWE25) GN=acpS PE=3 SV=1 1747 1859 4.0E-08
sp|Q8XAN7|ACPS2_ECO57 Probable holo-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O157:H7 GN=acpS2 PE=3 SV=1 1744 1859 6.0E-08
sp|C3LR00|ACPS_VIBCM Holo-[acyl-carrier-protein] synthase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=acpS PE=3 SV=1 1745 1859 6.0E-08
sp|Q9KPB6|ACPS_VIBCH Holo-[acyl-carrier-protein] synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=acpS PE=1 SV=1 1745 1859 6.0E-08
sp|Q3B672|ACPS_CHLL7 Holo-[acyl-carrier-protein] synthase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=acpS PE=3 SV=1 1747 1859 8.0E-08
sp|A6Q7U5|ACPS_SULNB Holo-[acyl-carrier-protein] synthase OS=Sulfurovum sp. (strain NBC37-1) GN=acpS PE=3 SV=1 1744 1862 1.0E-07
sp|B3E694|ACPS_GEOLS Holo-[acyl-carrier-protein] synthase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=acpS PE=3 SV=1 1745 1859 1.0E-07
sp|Q28V25|ACPS_JANSC Holo-[acyl-carrier-protein] synthase OS=Jannaschia sp. (strain CCS1) GN=acpS PE=3 SV=1 1745 1857 1.0E-07
sp|B4SFE8|ACPS_PELPB Holo-[acyl-carrier-protein] synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=acpS PE=3 SV=1 1745 1859 2.0E-07
sp|P73283|FABF_SYNY3 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabF PE=1 SV=1 1200 1393 2.0E-07
sp|B8IZX1|ACPS_DESDA Holo-[acyl-carrier-protein] synthase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=acpS PE=3 SV=1 1745 1859 3.0E-07
sp|Q6LMS5|ACPS_PHOPR Holo-[acyl-carrier-protein] synthase OS=Photobacterium profundum GN=acpS PE=3 SV=1 1745 1859 3.0E-07
sp|A1WKY6|ACPS_VEREI Holo-[acyl-carrier-protein] synthase OS=Verminephrobacter eiseniae (strain EF01-2) GN=acpS PE=3 SV=1 1744 1859 3.0E-07
sp|Q72AT2|ACPS_DESVH Holo-[acyl-carrier-protein] synthase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=acpS PE=3 SV=1 1745 1859 4.0E-07
sp|P63472|ACPS_STRA5 Holo-[acyl-carrier-protein] synthase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=acpS PE=3 SV=1 1746 1826 4.0E-07
sp|P63471|ACPS_STRA3 Holo-[acyl-carrier-protein] synthase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=acpS PE=3 SV=1 1746 1826 4.0E-07
sp|Q3JZK4|ACPS_STRA1 Holo-[acyl-carrier-protein] synthase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=acpS PE=3 SV=1 1746 1826 4.0E-07
sp|Q8RDZ7|ACPS_FUSNN Holo-[acyl-carrier-protein] synthase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=acpS PE=3 SV=1 1745 1859 5.0E-07
sp|Q053N9|ACPS_LEPBL Holo-[acyl-carrier-protein] synthase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=acpS PE=3 SV=1 1760 1859 6.0E-07
sp|Q04U76|ACPS_LEPBJ Holo-[acyl-carrier-protein] synthase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=acpS PE=3 SV=1 1760 1859 6.0E-07
sp|Q8F136|ACPS_LEPIN Holo-[acyl-carrier-protein] synthase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=acpS PE=3 SV=1 1760 1859 6.0E-07
sp|Q72U18|ACPS_LEPIC Holo-[acyl-carrier-protein] synthase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=acpS PE=3 SV=1 1760 1859 6.0E-07
sp|A8GI21|ACPS_SERP5 Holo-[acyl-carrier-protein] synthase OS=Serratia proteamaculans (strain 568) GN=acpS PE=3 SV=1 1745 1859 6.0E-07
sp|O34340|FABF_BACSU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Bacillus subtilis (strain 168) GN=fabF PE=1 SV=1 1215 1416 1.0E-06
sp|Q3AU14|ACPS_CHLCH Holo-[acyl-carrier-protein] synthase OS=Chlorobium chlorochromatii (strain CaD3) GN=acpS PE=3 SV=1 1745 1859 1.0E-06
sp|B5XNH4|ACPS_KLEP3 Holo-[acyl-carrier-protein] synthase OS=Klebsiella pneumoniae (strain 342) GN=acpS PE=3 SV=1 1745 1859 2.0E-06
sp|A1VCV8|ACPS_DESVV Holo-[acyl-carrier-protein] synthase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=acpS PE=3 SV=1 1745 1859 2.0E-06
sp|C4L132|ACPS_EXISA Holo-[acyl-carrier-protein] synthase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=acpS PE=3 SV=1 1745 1856 2.0E-06
sp|B4RXM9|ACPS_ALTMD Holo-[acyl-carrier-protein] synthase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=acpS PE=3 SV=1 1745 1859 2.0E-06
sp|A1JKK7|ACPS_YERE8 Holo-[acyl-carrier-protein] synthase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=acpS PE=3 SV=1 1745 1859 3.0E-06
sp|B1JRD1|ACPS_YERPY Holo-[acyl-carrier-protein] synthase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=acpS PE=3 SV=1 1745 1859 4.0E-06
sp|Q667V4|ACPS_YERPS Holo-[acyl-carrier-protein] synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=acpS PE=3 SV=1 1745 1859 4.0E-06
sp|B2KA43|ACPS_YERPB Holo-[acyl-carrier-protein] synthase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=acpS PE=3 SV=1 1745 1859 4.0E-06
sp|A7FFU3|ACPS_YERP3 Holo-[acyl-carrier-protein] synthase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=acpS PE=3 SV=1 1745 1859 4.0E-06
sp|A4TKX4|ACPS_YERPP Holo-[acyl-carrier-protein] synthase OS=Yersinia pestis (strain Pestoides F) GN=acpS PE=3 SV=1 1745 1859 4.0E-06
sp|Q1CKE0|ACPS_YERPN Holo-[acyl-carrier-protein] synthase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=acpS PE=3 SV=1 1745 1859 4.0E-06
sp|A9R406|ACPS_YERPG Holo-[acyl-carrier-protein] synthase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=acpS PE=3 SV=1 1745 1859 4.0E-06
sp|Q8ZCP5|ACPS_YERPE Holo-[acyl-carrier-protein] synthase OS=Yersinia pestis GN=acpS PE=3 SV=1 1745 1859 4.0E-06
sp|Q1C5D9|ACPS_YERPA Holo-[acyl-carrier-protein] synthase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=acpS PE=3 SV=1 1745 1859 4.0E-06
sp|A8M4B5|ACPS_SALAI Holo-[acyl-carrier-protein] synthase OS=Salinispora arenicola (strain CNS-205) GN=acpS PE=3 SV=1 1765 1860 5.0E-06
sp|A6W5X5|ACPS_KINRD Holo-[acyl-carrier-protein] synthase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=acpS PE=3 SV=1 1781 1860 5.0E-06
sp|B5YJG8|ACPS_THEYD Holo-[acyl-carrier-protein] synthase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=acpS PE=3 SV=1 1745 1859 5.0E-06
sp|B7VK75|ACPS_VIBTL Holo-[acyl-carrier-protein] synthase OS=Vibrio tasmaniensis (strain LGP32) GN=acpS PE=3 SV=1 1745 1859 6.0E-06
sp|A0RPF9|ACPS_CAMFF Holo-[acyl-carrier-protein] synthase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=acpS PE=3 SV=1 1745 1859 6.0E-06
sp|P72331|NODE_RHIS3 Nodulation protein E OS=Rhizobium sp. (strain N33) GN=nodE PE=3 SV=1 1494 1602 6.0E-06
sp|A6TCH7|ACPS_KLEP7 Holo-[acyl-carrier-protein] synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=acpS PE=3 SV=1 1745 1859 7.0E-06
sp|Q30SB4|ACPS_SULDN Holo-[acyl-carrier-protein] synthase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=acpS PE=3 SV=1 1771 1857 7.0E-06
sp|Q6D222|ACPS_PECAS Holo-[acyl-carrier-protein] synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=acpS PE=3 SV=1 1745 1859 7.0E-06
sp|A4WDD4|ACPS_ENT38 Holo-[acyl-carrier-protein] synthase OS=Enterobacter sp. (strain 638) GN=acpS PE=3 SV=1 1745 1859 7.0E-06
sp|C5D4D1|ACPS_GEOSW Holo-[acyl-carrier-protein] synthase OS=Geobacillus sp. (strain WCH70) GN=acpS PE=3 SV=1 1747 1859 8.0E-06
sp|A4XBI2|ACPS_SALTO Holo-[acyl-carrier-protein] synthase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=acpS PE=3 SV=1 1765 1860 8.0E-06
sp|P24224|ACPS_ECOLI Holo-[acyl-carrier-protein] synthase OS=Escherichia coli (strain K12) GN=acpS PE=1 SV=3 1745 1859 9.0E-06
sp|C4ZYI6|ACPS_ECOBW Holo-[acyl-carrier-protein] synthase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=acpS PE=3 SV=1 1745 1859 9.0E-06
sp|Q7MHP2|ACPS_VIBVY Holo-[acyl-carrier-protein] synthase OS=Vibrio vulnificus (strain YJ016) GN=acpS PE=3 SV=1 1745 1859 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0008897 holo-[acyl-carrier-protein] synthase activity Yes
GO:0000287 magnesium ion binding Yes
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0016780 phosphotransferase activity, for other substituted phosphate groups No
GO:0003824 catalytic activity No
GO:0043167 ion binding No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5044
MRPEIEQELAHTLLIELLAYQFASPVRWIETQDVFLAERTAERIVEIGPADTLGVMAKRTLSSKYEAYDAAKSVQ
RQILCYNKDAKEIYYDVDPVEEEPEPAAASAGSAASSATTATAAAPASTTTAAAPPPPSSGPAAQIPDEPVQAID
IVRALIAQKLKKPLLDIPLSKAIKDLVGGKSTLQNEILGDLGKEFGSTPEKPEDTPLDELGASMQATFDGSLGKQ
SQSLIARLISSKMPGGFNITAARKYLETRWGLGPGRQDGALLLALTMEPPSRLGSEADAKGFLDDVTQKFASHAG
FSLSTASAAGSSGAGGGGMMMDPAAIDALTKDQRALFKQQLELFARYLKMDLRSGDKAFISSQKSEKVLQAQLDL
WAAEHGDFYAAGIEPVFSPLKARTYDSSWNWARQDALSMYFDIIFGRLQVVDREIVSQCIRIMNRSNPKLLDFMQ
YHIDNCPTERGETYKLAKELGEQLIENCKDVLNISPVYKDIAIPTGPRTTVDARGNLNYEEVPRASCRKLEHYVQ
QMAEGGKISEYGNRTKVQSDLQRIYKLIRQQHKMSKTSQLEIKSLYGDVLRSLAMNQSQILPKENGKSKKTSLKG
ANHKGRVETIPFLHLKRKSLHGWDYSKKLTAAYLNCLEDAAKSGVTYQGKYVLMTGAGAGSIGAEVLQGLVSGGA
RVVVTTSRFSRQVTEYYQSMYTRYGSRGSQIVVVPFNQGSKQDVEALVEYIYDTKNGLGWDLDFIVPFAAISENG
RQIDSIDSRSELAHRIMLTNLIRLLGCVKSQKTERGFETRPAQVVLPLSPNHGTFGNDGLYSESKLALETLFNRW
YSENWANYLTVCGAVIGWTRGTGLMSGNNIVAEGVEAFGVRTFSQQEMAFNLLGLMSPTIVDLCQAEPVFADLNG
GLQFIPNLNEAMTKLRKDIMETSEIRKAVAKESTIENTIVNGAESEALYKKKVIEPRANIKFDFPRLPEWQSEIA
PLSGTLKGMVDLEKVVVVTGFAEVGPWGNSRTRWEMEAHGEFSLEGCVEMAWIMGLIKNHNGPLKGKPYSGWVDG
KSGDPVDDKDIKAKYEKHILEHSGIRLIEPELFNGYDPNKKQLLHEVVIEEDLEPFEASKETAEEFKREHGDKVE
IFEIPDSGEYIIRMKKGASLWIPKALRFDRLVAGQIPTGWDPKRYGVPEDIISQVDPVTLFLLVSTAEALLSCGI
TDPYEFYKYVHVSEVGNCVGSGMGGAAALRGMHKDRFLDKPLQNDILQESFINTMAAWVNMLLISSSGPIKTPVG
ACATAVESVDIGYETIMEGKARVCFVGGFDDFGEEGSYEFANMKATSNTVDELQHGRTPKEMSRPTTTTRNGFME
SQGCGIQVIMTAKLALDMGVPIYGILALTTTASDKIGRSVPAPGQGVLTTAREHAGKFPSPLLDINYRRRQIERR
KKQIKQWQESELEFVHDEVDAMKAQEASFDDKEYVQERILHIEREAARQEKELLRSMGNNFWKNDSSIAPLRGAL
ATWGLTIDDLGVASFHGTSTKANDKNESSVICQQLRHLGRKKGNAVMGIFQKYLTGHPKGAAGAWMMNGCLQVLN
TGLVPGNRNADNVDPIMEDFDLIVYPSRSIQTDGIKAFSVTSFGFGQKGAQAIGIHPKYLFATLDERTYSQYCVK
VAARQKKAYRYFHNGLINNSLFVAKSSSPYTDEQLRTVLLNPDARVSADKRTSELKYADNVMKQSQRTISASRVG
ETQRMMEALAHKVANKNSRVGVDVEDISAVDISNDNFLRRNFTVQEMSYCHKTPSPQSSFTGRWSAKEAVFKSLG
VASRGAGAAMKDIEILRDDTGAPTVSLHGEAAAAAKKAGVKNVTLSISHSETQAIAVAVANF*
Coding >Hirsu2|5044
ATGCGGCCCGAAATCGAGCAAGAGCTCGCCCATACCCTGCTCATTGAGCTTCTCGCATACCAGTTCGCCTCGCCT
GTGAGATGGATCGAGACTCAAGACGTCTTCCTCGCCGAGAGGACGGCCGAGCGCATCGTCGAAATCGGCCCCGCT
GACACCTTGGGTGTCATGGCCAAGCGCACCCTATCCTCCAAATACGAGGCATATGACGCCGCAAAGTCCGTCCAA
CGGCAAATACTTTGCTATAACAAGGACGCCAAGGAGATTTACTATGATGTTGATCCCGTCGAGGAGGAACCCGAG
CCCGCAGCCGCATCTGCTGGCTCCGCAGCCTCGAGCGCCACCACTGCCACCGCTGCTGCTCCGGCCTCTACCACA
ACCGCCGCCGCTCCTCCGCCTCCAAGCTCTGGCCCCGCCGCCCAGATCCCCGATGAGCCGGTTCAGGCCATTGAT
ATAGTTCGCGCCTTGATCGCGCAAAAGCTCAAAAAACCCCTCCTTGACATTCCCCTCAGCAAGGCCATCAAGGAC
CTCGTCGGAGGCAAATCCACGCTTCAGAACGAAATCCTCGGAGATCTCGGCAAGGAGTTCGGCTCGACTCCCGAG
AAGCCAGAGGACACGCCTCTCGATGAGCTCGGTGCTTCCATGCAAGCAACCTTCGACGGCAGCCTCGGCAAGCAG
TCTCAATCGCTCATCGCGAGACTGATTTCATCCAAGATGCCAGGCGGCTTTAACATCACTGCTGCAAGGAAATAC
CTCGAGACCAGGTGGGGTCTCGGTCCCGGGCGTCAGGACGGAGCTCTGCTCCTGGCCTTGACCATGGAACCACCG
TCCCGCCTGGGCTCCGAGGCCGACGCCAAGGGATTCTTGGACGACGTGACCCAGAAGTTTGCCTCTCATGCAGGC
TTCTCCTTGTCTACTGCCTCGGCTGCCGGGTCATCTGGCGCCGGCGGTGGTGGTATGATGATGGACCCTGCTGCC
ATCGACGCCCTCACCAAGGACCAGCGAGCTCTCTTCAAGCAGCAGCTTGAGCTGTTCGCTCGCTACCTAAAGATG
GATCTCAGGTCAGGCGACAAGGCCTTCATCAGCTCTCAAAAGTCGGAGAAGGTGCTTCAGGCACAACTTGACTTG
TGGGCTGCCGAACATGGCGATTTCTACGCGGCCGGCATTGAGCCTGTCTTTAGCCCCCTCAAAGCCCGGACGTAC
GACTCGTCCTGGAACTGGGCCCGTCAAGACGCCCTCAGCATGTACTTTGACATCATCTTCGGCAGGCTGCAAGTT
GTCGACCGTGAGATTGTGAGCCAGTGCATCAGGATCATGAACCGATCAAATCCCAAGCTGCTCGACTTCATGCAG
TATCACATCGACAACTGCCCCACGGAGCGGGGCGAGACGTACAAGCTCGCCAAGGAGCTCGGAGAGCAGCTCATT
GAGAATTGCAAGGACGTTTTGAACATCTCTCCCGTGTACAAGGACATTGCTATTCCTACAGGCCCGCGCACCACC
GTTGATGCTCGCGGCAACCTCAACTACGAAGAGGTTCCCCGCGCGAGCTGCAGGAAGCTGGAGCATTACGTTCAG
CAGATGGCCGAGGGCGGCAAGATTTCCGAGTATGGGAATCGTACCAAGGTCCAGAGCGATTTGCAGCGCATATAC
AAGCTTATCAGGCAACAGCACAAGATGTCCAAGACTTCCCAGCTCGAGATCAAAAGCCTGTACGGTGACGTCTTG
CGCTCGCTCGCCATGAACCAAAGCCAGATACTGCCCAAAGAGAACGGCAAGAGCAAGAAAACGAGCCTCAAGGGC
GCCAATCACAAAGGCAGGGTCGAGACGATCCCGTTTCTGCACCTCAAGCGCAAGTCTCTCCACGGCTGGGACTAC
AGCAAGAAGCTCACCGCCGCTTATCTCAACTGCCTGGAAGACGCGGCCAAGTCGGGCGTGACCTACCAGGGCAAG
TATGTCCTCATGACTGGTGCCGGCGCTGGATCCATCGGCGCCGAGGTCTTGCAGGGGCTTGTCAGCGGCGGTGCC
AGAGTCGTGGTGACGACGAGTCGGTTTTCCAGACAGGTCACCGAGTACTACCAGTCCATGTATACCCGTTACGGC
TCGCGCGGCTCTCAGATCGTCGTCGTCCCCTTCAATCAGGGCAGCAAGCAGGACGTGGAGGCACTGGTCGAGTAC
ATTTACGACACCAAGAATGGCCTTGGCTGGGATCTCGACTTCATCGTCCCTTTTGCTGCCATCTCGGAGAATGGC
CGCCAGATCGACAGCATTGATTCCAGGTCAGAGCTTGCCCACCGAATCATGCTCACCAACCTGATCCGGCTTCTC
GGTTGCGTCAAGTCCCAGAAGACCGAGAGAGGCTTTGAGACTCGGCCGGCCCAGGTTGTTCTTCCCCTCTCCCCC
AATCACGGTACCTTTGGCAACGATGGACTGTACTCGGAGTCCAAGCTCGCTCTCGAGACGCTCTTCAACCGATGG
TACTCGGAGAACTGGGCCAACTATCTCACCGTCTGTGGTGCCGTCATTGGCTGGACCCGCGGTACTGGCCTCATG
TCTGGCAACAACATTGTCGCGGAGGGAGTAGAAGCATTTGGCGTTCGGACCTTCTCGCAGCAAGAGATGGCCTTC
AACCTCCTCGGCCTAATGTCCCCCACCATTGTTGATCTTTGCCAAGCTGAACCGGTCTTCGCCGACCTCAACGGT
GGCCTCCAGTTCATCCCCAACCTCAACGAGGCCATGACCAAGCTTCGTAAGGACATCATGGAGACGAGCGAAATC
CGCAAGGCCGTGGCGAAGGAGAGCACCATTGAGAATACTATTGTCAATGGTGCCGAGTCTGAGGCCCTCTATAAA
AAGAAGGTAATTGAGCCCCGTGCCAACATCAAGTTCGACTTTCCTCGTCTGCCAGAGTGGCAGAGCGAGATCGCG
CCTCTCAGCGGTACTCTCAAGGGCATGGTGGATCTTGAAAAGGTCGTCGTCGTCACTGGCTTTGCCGAGGTCGGC
CCTTGGGGCAACTCCCGCACCCGGTGGGAGATGGAGGCTCATGGCGAGTTCTCTCTGGAGGGCTGTGTCGAAATG
GCGTGGATCATGGGCCTCATCAAGAATCACAACGGTCCGCTCAAGGGCAAGCCCTACTCTGGATGGGTCGACGGC
AAATCTGGTGATCCCGTTGATGATAAGGATATCAAGGCCAAATATGAGAAGCATATTCTGGAACACTCTGGTATT
CGTCTGATTGAGCCCGAGTTGTTCAACGGGTACGACCCCAACAAGAAACAGCTGCTTCACGAGGTGGTCATCGAA
GAAGACCTTGAGCCATTCGAGGCCTCCAAAGAGACAGCCGAGGAATTCAAGCGCGAGCATGGTGACAAGGTCGAA
ATTTTCGAAATTCCCGACAGCGGAGAGTACATCATTCGCATGAAGAAGGGTGCCTCTCTCTGGATCCCCAAGGCA
CTCCGCTTCGACCGCCTCGTCGCCGGTCAGATCCCGACCGGCTGGGACCCCAAGCGCTACGGCGTTCCCGAGGAC
ATCATCTCTCAGGTCGACCCTGTCACCTTGTTCTTGCTTGTATCCACAGCTGAGGCCCTACTTTCTTGCGGCATC
ACGGACCCCTACGAGTTTTACAAGTACGTCCATGTCTCCGAGGTGGGCAATTGCGTCGGCTCCGGCATGGGTGGC
GCTGCGGCCCTCCGCGGCATGCACAAGGATCGCTTCCTGGATAAGCCCCTCCAGAACGACATATTGCAAGAGTCG
TTCATCAACACCATGGCCGCCTGGGTCAACATGCTGCTTATCTCCTCGTCTGGGCCCATCAAGACCCCTGTCGGC
GCCTGCGCCACCGCGGTCGAGTCGGTCGACATTGGCTACGAGACTATTATGGAGGGCAAGGCCCGCGTTTGCTTT
GTCGGTGGCTTCGATGATTTCGGAGAGGAAGGGTCGTACGAGTTCGCCAACATGAAGGCGACAAGCAACACAGTG
GATGAGCTCCAGCATGGTCGAACCCCCAAGGAGATGTCTCGCCCCACAACGACAACCAGAAACGGCTTCATGGAA
TCTCAGGGCTGCGGCATCCAGGTCATCATGACTGCGAAGCTGGCCCTCGACATGGGCGTTCCTATTTACGGTATT
CTGGCTCTCACCACGACTGCGTCCGACAAGATCGGTCGCTCCGTCCCTGCCCCAGGCCAAGGTGTCCTCACCACG
GCCCGCGAGCATGCCGGCAAGTTTCCGTCGCCGTTACTCGATATCAACTATCGCCGACGACAAATTGAGCGCCGC
AAGAAGCAGATCAAGCAATGGCAGGAGTCGGAGCTCGAATTCGTGCATGACGAAGTCGACGCCATGAAAGCTCAG
GAGGCCTCCTTCGACGACAAGGAATATGTACAAGAGCGTATTCTGCACATAGAAAGGGAGGCTGCTCGACAGGAA
AAGGAACTCCTGCGAAGCATGGGCAACAACTTTTGGAAGAACGACTCAAGCATTGCGCCGCTGCGCGGTGCTCTG
GCCACCTGGGGTCTGACTATTGACGACTTGGGCGTCGCGTCCTTCCACGGCACGTCTACCAAGGCCAACGACAAG
AACGAGTCATCCGTCATCTGCCAACAACTTCGCCACCTTGGGCGGAAGAAGGGCAACGCCGTCATGGGTATTTTC
CAGAAATACCTCACCGGCCATCCGAAGGGTGCTGCCGGGGCCTGGATGATGAACGGCTGTTTGCAGGTTCTCAAC
ACGGGCCTTGTCCCCGGGAATCGCAACGCCGACAACGTCGATCCAATTATGGAGGACTTTGACTTGATCGTGTAC
CCAAGCCGCAGCATCCAGACTGATGGAATCAAGGCCTTCTCCGTCACGTCGTTCGGATTTGGCCAGAAGGGAGCT
CAGGCCATCGGCATTCACCCTAAATACTTGTTTGCTACTCTCGACGAGCGTACTTATAGCCAGTACTGTGTCAAG
GTTGCGGCCAGGCAGAAAAAGGCCTACCGCTACTTCCACAACGGCCTGATCAACAACAGCCTATTTGTCGCCAAG
TCGAGCTCTCCCTATACCGATGAGCAGCTCAGGACCGTCTTGCTCAACCCAGATGCCCGCGTGTCCGCGGACAAA
AGGACTTCCGAGCTGAAGTATGCCGACAACGTCATGAAGCAATCGCAGAGGACCATCTCAGCCTCGAGGGTCGGC
GAGACGCAAAGGATGATGGAGGCTCTGGCGCACAAGGTGGCCAACAAGAACAGCAGGGTCGGGGTTGACGTCGAA
GACATATCAGCCGTCGATATCAGCAACGACAACTTCTTGCGGCGAAACTTCACGGTACAGGAGATGAGTTACTGT
CACAAGACTCCGAGCCCGCAAAGCTCATTTACGGGCCGATGGAGTGCCAAGGAAGCGGTTTTCAAGTCGCTCGGC
GTGGCCAGCCGCGGGGCCGGCGCGGCCATGAAGGACATTGAAATTCTGAGGGATGATACGGGTGCTCCCACAGTA
TCGCTCCACGGCGAGGCCGCCGCCGCCGCCAAGAAGGCTGGCGTCAAGAACGTGACGCTGTCCATCTCGCATTCC
GAGACGCAAGCTATCGCCGTGGCGGTAGCAAATTTTTAA
Transcript >Hirsu2|5044
ATGCGGCCCGAAATCGAGCAAGAGCTCGCCCATACCCTGCTCATTGAGCTTCTCGCATACCAGTTCGCCTCGCCT
GTGAGATGGATCGAGACTCAAGACGTCTTCCTCGCCGAGAGGACGGCCGAGCGCATCGTCGAAATCGGCCCCGCT
GACACCTTGGGTGTCATGGCCAAGCGCACCCTATCCTCCAAATACGAGGCATATGACGCCGCAAAGTCCGTCCAA
CGGCAAATACTTTGCTATAACAAGGACGCCAAGGAGATTTACTATGATGTTGATCCCGTCGAGGAGGAACCCGAG
CCCGCAGCCGCATCTGCTGGCTCCGCAGCCTCGAGCGCCACCACTGCCACCGCTGCTGCTCCGGCCTCTACCACA
ACCGCCGCCGCTCCTCCGCCTCCAAGCTCTGGCCCCGCCGCCCAGATCCCCGATGAGCCGGTTCAGGCCATTGAT
ATAGTTCGCGCCTTGATCGCGCAAAAGCTCAAAAAACCCCTCCTTGACATTCCCCTCAGCAAGGCCATCAAGGAC
CTCGTCGGAGGCAAATCCACGCTTCAGAACGAAATCCTCGGAGATCTCGGCAAGGAGTTCGGCTCGACTCCCGAG
AAGCCAGAGGACACGCCTCTCGATGAGCTCGGTGCTTCCATGCAAGCAACCTTCGACGGCAGCCTCGGCAAGCAG
TCTCAATCGCTCATCGCGAGACTGATTTCATCCAAGATGCCAGGCGGCTTTAACATCACTGCTGCAAGGAAATAC
CTCGAGACCAGGTGGGGTCTCGGTCCCGGGCGTCAGGACGGAGCTCTGCTCCTGGCCTTGACCATGGAACCACCG
TCCCGCCTGGGCTCCGAGGCCGACGCCAAGGGATTCTTGGACGACGTGACCCAGAAGTTTGCCTCTCATGCAGGC
TTCTCCTTGTCTACTGCCTCGGCTGCCGGGTCATCTGGCGCCGGCGGTGGTGGTATGATGATGGACCCTGCTGCC
ATCGACGCCCTCACCAAGGACCAGCGAGCTCTCTTCAAGCAGCAGCTTGAGCTGTTCGCTCGCTACCTAAAGATG
GATCTCAGGTCAGGCGACAAGGCCTTCATCAGCTCTCAAAAGTCGGAGAAGGTGCTTCAGGCACAACTTGACTTG
TGGGCTGCCGAACATGGCGATTTCTACGCGGCCGGCATTGAGCCTGTCTTTAGCCCCCTCAAAGCCCGGACGTAC
GACTCGTCCTGGAACTGGGCCCGTCAAGACGCCCTCAGCATGTACTTTGACATCATCTTCGGCAGGCTGCAAGTT
GTCGACCGTGAGATTGTGAGCCAGTGCATCAGGATCATGAACCGATCAAATCCCAAGCTGCTCGACTTCATGCAG
TATCACATCGACAACTGCCCCACGGAGCGGGGCGAGACGTACAAGCTCGCCAAGGAGCTCGGAGAGCAGCTCATT
GAGAATTGCAAGGACGTTTTGAACATCTCTCCCGTGTACAAGGACATTGCTATTCCTACAGGCCCGCGCACCACC
GTTGATGCTCGCGGCAACCTCAACTACGAAGAGGTTCCCCGCGCGAGCTGCAGGAAGCTGGAGCATTACGTTCAG
CAGATGGCCGAGGGCGGCAAGATTTCCGAGTATGGGAATCGTACCAAGGTCCAGAGCGATTTGCAGCGCATATAC
AAGCTTATCAGGCAACAGCACAAGATGTCCAAGACTTCCCAGCTCGAGATCAAAAGCCTGTACGGTGACGTCTTG
CGCTCGCTCGCCATGAACCAAAGCCAGATACTGCCCAAAGAGAACGGCAAGAGCAAGAAAACGAGCCTCAAGGGC
GCCAATCACAAAGGCAGGGTCGAGACGATCCCGTTTCTGCACCTCAAGCGCAAGTCTCTCCACGGCTGGGACTAC
AGCAAGAAGCTCACCGCCGCTTATCTCAACTGCCTGGAAGACGCGGCCAAGTCGGGCGTGACCTACCAGGGCAAG
TATGTCCTCATGACTGGTGCCGGCGCTGGATCCATCGGCGCCGAGGTCTTGCAGGGGCTTGTCAGCGGCGGTGCC
AGAGTCGTGGTGACGACGAGTCGGTTTTCCAGACAGGTCACCGAGTACTACCAGTCCATGTATACCCGTTACGGC
TCGCGCGGCTCTCAGATCGTCGTCGTCCCCTTCAATCAGGGCAGCAAGCAGGACGTGGAGGCACTGGTCGAGTAC
ATTTACGACACCAAGAATGGCCTTGGCTGGGATCTCGACTTCATCGTCCCTTTTGCTGCCATCTCGGAGAATGGC
CGCCAGATCGACAGCATTGATTCCAGGTCAGAGCTTGCCCACCGAATCATGCTCACCAACCTGATCCGGCTTCTC
GGTTGCGTCAAGTCCCAGAAGACCGAGAGAGGCTTTGAGACTCGGCCGGCCCAGGTTGTTCTTCCCCTCTCCCCC
AATCACGGTACCTTTGGCAACGATGGACTGTACTCGGAGTCCAAGCTCGCTCTCGAGACGCTCTTCAACCGATGG
TACTCGGAGAACTGGGCCAACTATCTCACCGTCTGTGGTGCCGTCATTGGCTGGACCCGCGGTACTGGCCTCATG
TCTGGCAACAACATTGTCGCGGAGGGAGTAGAAGCATTTGGCGTTCGGACCTTCTCGCAGCAAGAGATGGCCTTC
AACCTCCTCGGCCTAATGTCCCCCACCATTGTTGATCTTTGCCAAGCTGAACCGGTCTTCGCCGACCTCAACGGT
GGCCTCCAGTTCATCCCCAACCTCAACGAGGCCATGACCAAGCTTCGTAAGGACATCATGGAGACGAGCGAAATC
CGCAAGGCCGTGGCGAAGGAGAGCACCATTGAGAATACTATTGTCAATGGTGCCGAGTCTGAGGCCCTCTATAAA
AAGAAGGTAATTGAGCCCCGTGCCAACATCAAGTTCGACTTTCCTCGTCTGCCAGAGTGGCAGAGCGAGATCGCG
CCTCTCAGCGGTACTCTCAAGGGCATGGTGGATCTTGAAAAGGTCGTCGTCGTCACTGGCTTTGCCGAGGTCGGC
CCTTGGGGCAACTCCCGCACCCGGTGGGAGATGGAGGCTCATGGCGAGTTCTCTCTGGAGGGCTGTGTCGAAATG
GCGTGGATCATGGGCCTCATCAAGAATCACAACGGTCCGCTCAAGGGCAAGCCCTACTCTGGATGGGTCGACGGC
AAATCTGGTGATCCCGTTGATGATAAGGATATCAAGGCCAAATATGAGAAGCATATTCTGGAACACTCTGGTATT
CGTCTGATTGAGCCCGAGTTGTTCAACGGGTACGACCCCAACAAGAAACAGCTGCTTCACGAGGTGGTCATCGAA
GAAGACCTTGAGCCATTCGAGGCCTCCAAAGAGACAGCCGAGGAATTCAAGCGCGAGCATGGTGACAAGGTCGAA
ATTTTCGAAATTCCCGACAGCGGAGAGTACATCATTCGCATGAAGAAGGGTGCCTCTCTCTGGATCCCCAAGGCA
CTCCGCTTCGACCGCCTCGTCGCCGGTCAGATCCCGACCGGCTGGGACCCCAAGCGCTACGGCGTTCCCGAGGAC
ATCATCTCTCAGGTCGACCCTGTCACCTTGTTCTTGCTTGTATCCACAGCTGAGGCCCTACTTTCTTGCGGCATC
ACGGACCCCTACGAGTTTTACAAGTACGTCCATGTCTCCGAGGTGGGCAATTGCGTCGGCTCCGGCATGGGTGGC
GCTGCGGCCCTCCGCGGCATGCACAAGGATCGCTTCCTGGATAAGCCCCTCCAGAACGACATATTGCAAGAGTCG
TTCATCAACACCATGGCCGCCTGGGTCAACATGCTGCTTATCTCCTCGTCTGGGCCCATCAAGACCCCTGTCGGC
GCCTGCGCCACCGCGGTCGAGTCGGTCGACATTGGCTACGAGACTATTATGGAGGGCAAGGCCCGCGTTTGCTTT
GTCGGTGGCTTCGATGATTTCGGAGAGGAAGGGTCGTACGAGTTCGCCAACATGAAGGCGACAAGCAACACAGTG
GATGAGCTCCAGCATGGTCGAACCCCCAAGGAGATGTCTCGCCCCACAACGACAACCAGAAACGGCTTCATGGAA
TCTCAGGGCTGCGGCATCCAGGTCATCATGACTGCGAAGCTGGCCCTCGACATGGGCGTTCCTATTTACGGTATT
CTGGCTCTCACCACGACTGCGTCCGACAAGATCGGTCGCTCCGTCCCTGCCCCAGGCCAAGGTGTCCTCACCACG
GCCCGCGAGCATGCCGGCAAGTTTCCGTCGCCGTTACTCGATATCAACTATCGCCGACGACAAATTGAGCGCCGC
AAGAAGCAGATCAAGCAATGGCAGGAGTCGGAGCTCGAATTCGTGCATGACGAAGTCGACGCCATGAAAGCTCAG
GAGGCCTCCTTCGACGACAAGGAATATGTACAAGAGCGTATTCTGCACATAGAAAGGGAGGCTGCTCGACAGGAA
AAGGAACTCCTGCGAAGCATGGGCAACAACTTTTGGAAGAACGACTCAAGCATTGCGCCGCTGCGCGGTGCTCTG
GCCACCTGGGGTCTGACTATTGACGACTTGGGCGTCGCGTCCTTCCACGGCACGTCTACCAAGGCCAACGACAAG
AACGAGTCATCCGTCATCTGCCAACAACTTCGCCACCTTGGGCGGAAGAAGGGCAACGCCGTCATGGGTATTTTC
CAGAAATACCTCACCGGCCATCCGAAGGGTGCTGCCGGGGCCTGGATGATGAACGGCTGTTTGCAGGTTCTCAAC
ACGGGCCTTGTCCCCGGGAATCGCAACGCCGACAACGTCGATCCAATTATGGAGGACTTTGACTTGATCGTGTAC
CCAAGCCGCAGCATCCAGACTGATGGAATCAAGGCCTTCTCCGTCACGTCGTTCGGATTTGGCCAGAAGGGAGCT
CAGGCCATCGGCATTCACCCTAAATACTTGTTTGCTACTCTCGACGAGCGTACTTATAGCCAGTACTGTGTCAAG
GTTGCGGCCAGGCAGAAAAAGGCCTACCGCTACTTCCACAACGGCCTGATCAACAACAGCCTATTTGTCGCCAAG
TCGAGCTCTCCCTATACCGATGAGCAGCTCAGGACCGTCTTGCTCAACCCAGATGCCCGCGTGTCCGCGGACAAA
AGGACTTCCGAGCTGAAGTATGCCGACAACGTCATGAAGCAATCGCAGAGGACCATCTCAGCCTCGAGGGTCGGC
GAGACGCAAAGGATGATGGAGGCTCTGGCGCACAAGGTGGCCAACAAGAACAGCAGGGTCGGGGTTGACGTCGAA
GACATATCAGCCGTCGATATCAGCAACGACAACTTCTTGCGGCGAAACTTCACGGTACAGGAGATGAGTTACTGT
CACAAGACTCCGAGCCCGCAAAGCTCATTTACGGGCCGATGGAGTGCCAAGGAAGCGGTTTTCAAGTCGCTCGGC
GTGGCCAGCCGCGGGGCCGGCGCGGCCATGAAGGACATTGAAATTCTGAGGGATGATACGGGTGCTCCCACAGTA
TCGCTCCACGGCGAGGCCGCCGCCGCCGCCAAGAAGGCTGGCGTCAAGAACGTGACGCTGTCCATCTCGCATTCC
GAGACGCAAGCTATCGCCGTGGCGGTAGCAAATTTTTAA
Gene >Hirsu2|5044
ATGCGGCCCGAAATCGAGCAAGAGCTCGCCCATACCCTGCTCATTGAGCTTCTCGCATACCAGTTCGCCTCGCCT
GTGAGATGGATCGAGACTCAAGACGTCTTCCTCGCCGAGAGGACGGCCGAGCGCATCGTCGAAATCGGCCCCGCT
GACACCTTGGGTGTCATGGCCAAGCGCACCCTATCCTCCAAATACGAGGCATATGACGCCGCAAAGTCCGTCCAA
CGGCAAATACTTTGCTATAACAAGGACGCCAAGGAGATTTACTATGATGTTGATCCCGTCGAGGAGGAACCCGAG
CCCGCAGCCGCATCTGCTGGCTCCGCAGCCTCGAGCGCCACCACTGCCACCGCTGCTGCTCCGGCCTCTACCACA
ACCGCCGCCGCTCCTCCGCCTCCAAGCTCTGGCCCCGCCGCCCAGATCCCCGATGAGCCGGTTCAGGCCATTGAT
ATAGTTCGCGCCTTGATCGCGCAAAAGCTCAAAAAACCCCTCCTTGACATTCCCCTCAGCAAGGCCATCAAGGAC
CTCGTCGGAGGTACGTCATCTATCTTCCCACCTTGAACGGCGCAATGTCTAATTGTGACGCAGGCAAATCCACGC
TTCAGAACGAAATCCTCGGAGATCTCGGCAAGGAGTTCGGCTCGACTCCCGAGAAGCCAGAGGACACGCCTCTCG
ATGAGCTCGGTGCTTCCATGCAAGCAACCTTCGACGGCAGCCTCGGCAAGCAGTCTCAATCGCTCATCGCGAGAC
TGATTTCATCCAAGATGCCAGGCGGCTTTAACATCACTGCTGCAAGGAAATACCTCGAGACCAGGTGGGGTCTCG
GTCCCGGGCGTCAGGACGGAGCTCTGCTCCTGGCCTTGACCATGGAACCACCGTCCCGCCTGGGCTCCGAGGCCG
ACGCCAAGGGATTCTTGGACGACGTGACCCAGAAGTTTGCCTCTCATGCAGGCTTCTCCTTGTCTACTGCCTCGG
CTGCCGGGTCATCTGGCGCCGGCGGTGGTGGTATGATGATGGACCCTGCTGCCATCGACGCCCTCACCAAGGACC
AGCGAGCTCTCTTCAAGCAGCAGCTTGAGCTGTTCGCTCGCTACCTAAAGATGGATCTCAGGTCAGGCGACAAGG
CCTTCATCAGCTCTCAAAAGTCGGAGAAGGTGCTTCAGGCACAACTTGACTTGTGGGCTGCCGAACATGGCGATT
TCTACGCGGCCGGCATTGAGCCTGTCTTTAGCCCCCTCAAAGCCCGGACGTACGACTCGTCCTGGAACTGGGCCC
GTCAAGACGCCCTCAGCATGTACTTTGACATCATCTTCGGCAGGCTGCAAGTTGTCGACCGTGAGATTGTGAGCC
AGTGCATCAGGATCATGAACCGATCAAATCCCAAGCTGCTCGACTTCATGCAGTATCACATCGACAACTGCCCCA
CGGAGCGGGGCGAGACGTACAAGCTCGCCAAGGAGCTCGGAGAGCAGCTCATTGAGAATTGCAAGGACGTTTTGA
ACATCTCTCCCGTGTACAAGGACATTGCTATTCCTACAGGCCCGCGCACCACCGTTGATGCTCGCGGCAACCTCA
ACTACGAAGAGGTTCCCCGCGCGAGCTGCAGGAAGCTGGAGCATTACGTTCAGCAGATGGCCGAGGGCGGCAAGA
TTTCCGAGTATGGGAATCGTACCAAGGTCCAGAGCGATTTGCAGCGCATATACAAGCTTATCAGGCAACAGCACA
AGATGTCCAAGACTTCCCAGCTCGAGATCAAAAGCCTGTACGGTGACGTCTTGCGCTCGCTCGCCATGAACCAAA
GCCAGATACTGCCCAAAGAGAACGGCAAGAGCAAGAAAACGAGCCTCAAGGGCGCCAATCACAAAGGCAGGGTCG
AGACGATCCCGTTTCTGCACCTCAAGCGCAAGTCTCTCCACGGCTGGGACTACAGCAAGAAGCTCACCGCCGCTT
ATCTCAACTGCCTGGAAGACGCGGCCAAGTCGGGCGTGACCTACCAGGGCAAGTATGTCCTCATGACTGGTGCCG
GCGCTGGATCCATCGGCGCCGAGGTCTTGCAGGGGCTTGTCAGCGGCGGTGCCAGAGTCGTGGTGACGACGAGTC
GGTTTTCCAGACAGGTCACCGAGTACTACCAGTCCATGTATACCCGTTACGGCTCGCGCGGCTCTCAGATCGTCG
TCGTCCCCTTCAATCAGGGCAGCAAGCAGGACGTGGAGGCACTGGTCGAGTACATTTACGACACCAAGAATGGCC
TTGGCTGGGATCTCGACTTCATCGTCCCTTTTGCTGCCATCTCGGAGAATGGCCGCCAGATCGACAGCATTGATT
CCAGGTCAGAGCTTGCCCACCGAATCATGCTCACCAACCTGATCCGGCTTCTCGGTTGCGTCAAGTCCCAGAAGA
CCGAGAGAGGCTTTGAGACTCGGCCGGCCCAGGTTGTTCTTCCCCTCTCCCCCAATCACGGTACCTTTGGCAACG
ATGGACTGTACTCGGAGTCCAAGCTCGCTCTCGAGACGCTCTTCAACCGATGGTACTCGGAGAACTGGGCCAACT
ATCTCACCGTCTGTGGTGCCGTCATTGGCTGGACCCGCGGTACTGGCCTCATGTCTGGCAACAACATTGTCGCGG
AGGGAGTAGAAGCATTTGGCGTTCGGACCTTCTCGCAGCAAGAGATGGCCTTCAACCTCCTCGGCCTAATGTCCC
CCACCATTGTTGATCTTTGCCAAGCTGAACCGGTCTTCGCCGACCTCAACGGTGGCCTCCAGTTCATCCCCAACC
TCAACGAGGCCATGACCAAGCTTCGTAAGGACATCATGGAGACGAGCGAAATCCGCAAGGCCGTGGCGAAGGAGA
GCACCATTGAGAATACTATTGTCAATGGTGCCGAGTCTGAGGCCCTCTATAAAAAGAAGGTAATTGAGCCCCGTG
CCAACATCAAGTTCGACTTTCCTCGTCTGCCAGAGTGGCAGAGCGAGATCGCGCCTCTCAGCGGTACTCTCAAGG
GCATGGTGGATCTTGAAAAGGTCGTCGTCGTCACTGGCTTTGCCGAGGTCGGCCCTTGGGGCAACTCCCGCACCC
GGTGGGAGATGGAGGCTCATGGCGAGTTCTCTCTGGAGGGCTGTGTCGAAATGGCGTGGATCATGGGCCTCATCA
AGAATCACAACGGTCCGCTCAAGGGCAAGCCCTACTCTGGATGGGTCGACGGCAAATCTGGTGATCCCGTTGATG
ATAAGGATATCAAGGCCAAATATGAGAAGCATATTCTGGAACACTCTGGTATTCGTCTGATTGAGCCCGAGTTGT
TCAACGGGTACGACCCCAACAAGAAACAGCTGCTTCACGAGGTGGTCATCGAAGAAGACCTTGAGCCATTCGAGG
CCTCCAAAGAGACAGCCGAGGAATTCAAGCGCGAGCATGGTGACAAGGTCGAAATTTTCGAAATTCCCGACAGCG
GAGAGTACATCATTCGCATGAAGAAGGGTGCCTCTCTCTGGATCCCCAAGGCACTCCGCTTCGACCGCCTCGTCG
CCGGTCAGATCCCGACCGGCTGGGACCCCAAGCGCTACGGCGTTCCCGAGGACATCATCTCTCAGGTCGACCCTG
TCACCTTGTTCTTGCTTGTATCCACAGCTGAGGCCCTACTTTCTTGCGGCATCACGGACCCCTACGAGTTTTACA
AGTACGTCCATGTCTCCGAGGTGGGCAATTGCGTCGGCTCCGGCATGGGTGGCGCTGCGGCCCTCCGCGGCATGC
ACAAGGATCGCTTCCTGGATAAGCCCCTCCAGAACGACATATTGCAAGAGTCGTTCATCAACACCATGGCCGCCT
GGGTCAACATGCTGCTTATCTCCTCGTCTGGGCCCATCAAGACCCCTGTCGGCGCCTGCGCCACCGCGGTCGAGT
CGGTCGACATTGGCTACGAGACTATTATGGAGGGCAAGGCCCGCGTTTGCTTTGTCGGTGGCTTCGATGATTTCG
GAGAGGAAGGGTCGTACGAGTTCGCCAACATGAAGGCGACAAGCAACACAGTGGATGAGCTCCAGCATGGTCGAA
CCCCCAAGGAGATGTCTCGCCCCACAACGACAACCAGAAACGGCTTCATGGAATCTCAGGGCTGCGGCATCCAGG
TCATCATGACTGCGAAGCTGGCCCTCGACATGGGCGTTCCTATTTACGGTATTCTGGCTCTCACCACGACTGCGT
CCGACAAGATCGGTCGCTCCGTCCCTGCCCCAGGCCAAGGTGTCCTCACCACGGCCCGCGAGCATGCCGGCAAGT
TTCCGTCGCCGTTACTCGATATCAACTATCGCCGACGACAAATTGAGCGCCGCAAGAAGCAGATCAAGCAATGGC
AGGAGTCGGAGCTCGAATTCGTGCATGACGAAGTCGACGCCATGAAAGCTCAGGAGGCCTCCTTCGACGACAAGG
AATATGTACAAGAGCGTATTCTGCACATAGAAAGGGAGGCTGCTCGACAGGAAAAGGAACTCCTGCGAAGCATGG
GCAACAACTTTTGGAAGAACGACTCAAGCATTGCGCCGCTGCGCGGTGCTCTGGCCACCTGGGGTCTGACTATTG
ACGACTTGGGCGTCGCGTCCTTCCACGGCACGTCTACCAAGGCCAACGACAAGAACGAGTCATCCGTCATCTGCC
AACAACTTCGCCACCTTGGGCGGAAGAAGGGCAACGCCGTCATGGGTATTTTCCAGAAATACCTCACCGGCCATC
CGAAGGGTGCTGCCGGGGCCTGGATGATGAACGGCTGTTTGCAGGTTCTCAACACGGGCCTTGTCCCCGGGAATC
GCAACGCCGACAACGTCGATCCAATTATGGAGGACTTTGACTTGATCGTGTACCCAAGCCGCAGCATCCAGACTG
ATGGAATCAAGGCCTTCTCCGTCACGTCGTTCGGATTTGGCCAGAAGGGAGCTCAGGCCATCGGCATTCACCCTA
AATACTTGTTTGCTACTCTCGACGAGCGTACTTATAGCCAGTACTGTGTCAAGGTTGCGGCCAGGCAGAAAAAGG
CCTACCGCTACTTCCACAACGGCCTGATCAACAACAGCCTATTTGTCGCCAAGTCGAGCTCTCCCTATACCGATG
AGCAGCTCAGGACCGTCTTGCTCAACCCAGATGCCCGCGTGTCCGCGGACAAAAGGACTTCCGAGCTGAAGTATG
CCGACAACGTCATGAAGCAATCGCAGAGGACCATCTCAGCCTCGAGGGTCGGCGAGACGCAAAGGATGATGGAGG
CTCTGGCGCACAAGGTGGCCAACAAGAACAGCAGGGTCGGGGTTGACGTCGAAGACATATCAGCCGTCGATATCA
GCAACGACAACTTCTTGCGGCGAAACTTCACGGTACAGGAGATGAGTTACTGTCACAAGACTCCGAGCCCGCAAA
GCTCATTTACGGGCCGATGGAGTGCCAAGGAAGCGGTTTTCAAGTCGCTCGGCGTGGCCAGCCGCGGGGCCGGCG
CGGCCATGAAGGACATTGAAATTCTGAGGGATGATACGGGTGCTCCCACAGTATCGGTAAGGGTGCTCACACCAA
GATATGTCTAATCGAACGCGATACTGACCTTGTTTGCCTGCGTCAGCTCCACGGCGAGGCCGCCGCCGCCGCCAA
GAAGGCTGGCGTCAAGAACGTGACGCTGTCCATCTCGCATTCCGAGACGCAAGCTATCGCCGTGGCGGTAGCAAA
TTTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail