Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5043
Gene name
LocationContig_253:4855..11258
Strand-
Gene length (bp)6403
Transcript length (bp)6309
Coding sequence length (bp)6309
Protein length (aa) 2103

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08354 DUF1729 Domain of unknown function (DUF1729) 1.8E-159 739 1088
PF00698 Acyl_transf_1 Acyl transferase domain 5.8E-86 1694 2064
PF17951 FAS_meander Fatty acid synthase meander beta sheet domain 1.3E-52 1153 1296
PF17828 FAS_N N-terminal domain in fatty acid synthase subunit beta 4.3E-38 20 145
PF01575 MaoC_dehydratas MaoC like domain 5.8E-37 1550 1678
PF16073 SAT Starter unit:ACP transacylase in aflatoxin biosynthesis 3.7E-35 172 424
PF13452 MaoC_dehydrat_N N-terminal half of MaoC dehydratase 7.3E-26 1304 1429

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P34229|FAS1_YARLI Fatty acid synthase subunit beta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FAS1 PE=3 SV=2 8 2077 0.0E+00
sp|P34731|FAS1_CANAX Fatty acid synthase subunit beta OS=Candida albicans GN=FAS1 PE=3 SV=1 19 2077 0.0E+00
sp|Q92215|TOXC_COCCA Putative fatty acid synthase subunit TOXC OS=Cochliobolus carbonum GN=TOXC PE=3 SV=1 20 2081 0.0E+00
sp|P07149|FAS1_YEAST Fatty acid synthase subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAS1 PE=1 SV=2 20 2079 0.0E+00
sp|Q9UUG0|FAS1_SCHPO Fatty acid synthase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fas1 PE=1 SV=1 18 2077 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P34229|FAS1_YARLI Fatty acid synthase subunit beta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FAS1 PE=3 SV=2 8 2077 0.0E+00
sp|P34731|FAS1_CANAX Fatty acid synthase subunit beta OS=Candida albicans GN=FAS1 PE=3 SV=1 19 2077 0.0E+00
sp|Q92215|TOXC_COCCA Putative fatty acid synthase subunit TOXC OS=Cochliobolus carbonum GN=TOXC PE=3 SV=1 20 2081 0.0E+00
sp|P07149|FAS1_YEAST Fatty acid synthase subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAS1 PE=1 SV=2 20 2079 0.0E+00
sp|Q9UUG0|FAS1_SCHPO Fatty acid synthase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fas1 PE=1 SV=1 18 2077 0.0E+00
sp|Q00706|STCK_EMENI Putative sterigmatocystin biosynthesis fatty acid synthase subunit beta OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcK PE=3 SV=2 156 2064 0.0E+00
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 1779 2007 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004318 enoyl-[acyl-carrier-protein] reductase (NADH) activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors No
GO:0016491 oxidoreductase activity No
GO:0008152 metabolic process No
GO:0004312 fatty acid synthase activity No
GO:0008150 biological_process No
GO:0016746 transferase activity, transferring acyl groups No
GO:0016747 transferase activity, transferring acyl groups other than amino-acyl groups No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016628 oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5043
MYGTGTGPQTGISTPRSNSSLRPLTLAHGSLETSFLIPTNLHFHASQLKDRFVASLPTATDELAQDDEPSSVPEL
VARYLGFVAREVEEGEDDAQGSYEEVLKLVLNEFERAFLRGNEVHAVAATLPGIESKKLEVIRSYYLARAVSNRT
IKPHESALLRASDDGSAEIFTIFGGQGNIEEYFEELREVFRTYPSFVGELITSAAEQLQTLSNHPSAEKMFPKGL
DIMNWLQHPDSTPDVDYLISAPVSFPLIGLVQMTHYEVTCKVLGIDPGQLRERISGTTGHSQGIVMAAATAAADS
WDSWRDIVSSTLAILFWIGTRSQQAFPTTSMTPTMLRESMDHGEGTPTPMLSIRDLSQQEVQKHIDATNQYLPPD
RHISVSLINSPRNLVVTGPPTSLYGLNSQLRKVKAPTGLDQNRVPYTERKIRFVNRFLPITAPFHSKYLSEATAM
IDEDLKDVSIESGSLGIPVFDTNTGKNLRSETGGNIVPALVRLITRDPVNWEKATVFGKATHILDFGPGGVSGLG
VLTSRNKEGTGVRVILAGTVDGTITEVGYKPELFDRDEDNAIRYAIDWVKEFAPRLVKTSSGQKYVDTRMSRLLG
LPPVMVAAMAPATAPWDFVAATMNAGYHIELAGGAYFNAKKMTDALSKIEKAIPAGRGISVNLIYVNPRAMAWQI
PLIGRLRSEGVPIQGLTIGAGVPSIEVAQEYIDTLGLKHIAFKPGSVEAIQAVINIAKANPSFPVILQWTGGRGG
GHHSYEDFHQPMLQMYGRVRRQDNIVLVAGSGFGGADDTYPYITGDWAKKYGYPPMPFDGCLFGSRMMVAREAHT
SKSAKQAIVDAPGVGDGEWEKTYKGPAGGVITVRSEMGEPIHKLATRGVRFWAEMDQKIFSLPKEKRVAELKKSR
EYIIKKLNDDFQKVWFGCNKSGKAVDLEDMTYAEVVRRLVELLYVKHQSRWIDPSFARLTGDFIHRVEERFTTAP
GQPSRLQNYSDLDEPFSAVDRILAHYPEAETQIINAQDVQHVLLLCMRRGQKPVTFIPALDENFEFFFKKDSLWQ
SEDLDAVIGQDVGRTCILQGPTAAKFSTVLDEPIKDILDGIHHAHITALTRDYYNNDERSIPAVEYFGGKLVEPE
VPLDVEGLTVHYDTHKNTYRLSSSPTAVLPSLDSWLSLLAGPNRNWRYALLMSDIVVQGQKFQTNPIRRIFAPVR
GLFVEIEFPNEPDKTSIVVREQPRHNQYVDVIEVKLTGKNEILVNLIKDTTALGKPVAMPLKFTYRPEAGYAPIH
EVMQDRNDRIKEFYWKAWFGNDPLNLDAVVTSKFDGGRTTITSEAIRDFVHAVGNTGEAFVDRPGKTVYAPMDFA
IVVGWKAITKPIFPRTIDGDLLKLVHLSNQFRMIHGAEPLKKGDEISTTAQINAVINQDSGKMVEVCGTIVRDGK
PVMEVTSQFLYRGAYLDYENTFQRKVETPVQVQLATSKDVAVLRSKNWFAIDEVPSDIDLLGQTLTFRLQSLVRY
KNKNVFSSIETRGQVLLELPTKEVIQVASVDYEAGESHGNPVIDYLERNGSPLDQPIYFENPIPLSGKTPLQLRA
PASNETYARVSGDYNPIHVSRVFSSYANLPGTITHGMYSSAAVRSLLETWAAENDIGRVRSFHASLVGMVLPNDD
IQVKLQHVGMVAGRKIIKVEVNNTETEEKVLLGEAEIEQPVTAYVFTGQGSQEQGMGMELYASSAVAKEVWDRAD
HYLLDNYGFSITNIVKNNPKELTIHFGGPRGKAIRHNYMSMTFETVATDGSIKSERIFKEINEGTTCYTYRSPTG
LLSATQFTQPALTLMEKASFEDMKARGLVPRDSTFAGHSLGEYSALAALADVMPIESLVSVVFYRGLTMQVAVER
DASGRSNYSMCAVNPSRISKTFNEEALQFVVNNIAEETGWLLEIVNYNIANMQYVCAGDLRALDTLAGVTNFVKK
QQIDIEEMRSNIEEAKGALREIIRGCAEATLKKPQPLELERGFATIPLRGIDVPFHSTFLRSGVKPFRSFLLKKI
NKTTIDPSKLVGKYIPNVTAKPFALTKDYFEEVYKLTNSPKIGAVLANWDKYAQDDDGRAGSESGSSVEYEGPGA
AA*
Coding >Hirsu2|5043
ATGTACGGGACGGGAACCGGCCCCCAGACGGGCATTTCCACCCCCAGATCTAATTCCTCGCTCCGGCCATTGACT
TTGGCCCATGGCTCCCTCGAAACATCGTTCCTCATCCCGACCAATCTCCATTTCCATGCCTCGCAGCTGAAAGAC
CGCTTCGTGGCTTCTCTGCCCACGGCCACCGACGAGCTTGCCCAGGATGACGAGCCTTCATCCGTACCCGAGCTG
GTTGCCAGATACCTGGGATTCGTGGCCCGCGAGGTGGAAGAGGGTGAGGATGACGCGCAAGGCTCATACGAGGAA
GTGCTCAAGCTCGTCCTCAACGAGTTTGAGAGAGCTTTCCTGCGCGGCAACGAGGTCCACGCCGTGGCCGCCACC
CTCCCGGGCATCGAGTCCAAGAAGCTCGAGGTGATTCGCAGCTACTACCTCGCCCGCGCTGTTTCCAACAGGACC
ATCAAACCACACGAGTCGGCCCTGCTGCGCGCTTCCGACGATGGCTCCGCTGAGATCTTTACCATCTTCGGCGGT
CAGGGCAACATTGAGGAGTACTTCGAGGAGCTTCGCGAGGTTTTCCGGACATACCCGAGCTTTGTCGGCGAGCTC
ATCACCTCCGCTGCCGAACAACTCCAGACGCTGTCCAACCACCCCAGCGCCGAAAAGATGTTCCCCAAGGGGCTC
GACATCATGAACTGGCTGCAGCACCCGGACTCTACCCCGGATGTCGACTACCTGATCTCGGCACCCGTCAGCTTT
CCCCTGATTGGGCTGGTTCAGATGACGCATTACGAGGTCACTTGCAAGGTGCTCGGCATCGACCCCGGCCAGCTG
CGGGAGCGCATCAGCGGCACTACCGGTCACTCCCAGGGCATCGTCATGGCCGCCGCCACTGCTGCCGCCGACTCC
TGGGACTCGTGGCGGGACATTGTGAGCTCGACTCTGGCGATCCTGTTCTGGATCGGAACACGAAGCCAGCAGGCG
TTCCCCACCACGTCCATGACGCCCACCATGCTGCGCGAGTCCATGGACCACGGCGAGGGCACGCCAACGCCTATG
CTCAGCATCCGAGATTTATCACAGCAGGAGGTCCAGAAGCATATCGATGCTACCAATCAATACCTTCCGCCGGAC
CGCCACATCAGTGTATCGCTCATCAATAGCCCGCGCAACCTTGTTGTCACGGGGCCACCTACCTCTCTCTACGGC
CTCAACTCGCAGCTGCGTAAAGTCAAGGCTCCCACGGGTCTTGATCAAAATCGTGTGCCATACACCGAGCGCAAG
ATCCGCTTCGTGAACCGATTCCTCCCCATCACTGCTCCATTTCACAGCAAATACCTCTCAGAGGCGACTGCTATG
ATCGACGAGGACCTCAAGGACGTCAGCATCGAGTCCGGCTCCCTGGGGATCCCCGTCTTCGACACAAATACGGGC
AAGAACCTCCGCTCTGAGACCGGTGGTAACATTGTCCCTGCCCTGGTCCGCCTGATCACCCGTGATCCTGTCAAC
TGGGAGAAGGCAACTGTCTTCGGCAAAGCAACACACATCCTCGACTTTGGCCCCGGCGGCGTGTCCGGTCTCGGT
GTCCTGACGAGCCGAAACAAGGAAGGAACCGGAGTCCGTGTGATTCTCGCCGGCACTGTGGATGGCACCATCACG
GAGGTCGGCTACAAGCCGGAGCTCTTCGATAGGGACGAAGATAATGCCATCAGGTATGCCATAGACTGGGTCAAG
GAGTTTGCTCCCAGATTAGTGAAGACGTCAAGCGGGCAGAAATATGTCGACACAAGGATGAGCCGTCTCCTCGGC
CTGCCCCCTGTCATGGTCGCCGCCATGGCTCCCGCCACGGCTCCCTGGGACTTTGTCGCCGCCACCATGAATGCG
GGATATCACATCGAACTCGCCGGTGGTGCCTACTTCAATGCGAAGAAGATGACGGACGCCCTTTCTAAAATCGAA
AAGGCAATTCCTGCGGGTCGCGGCATCTCCGTCAATCTTATTTACGTGAACCCGCGAGCTATGGCGTGGCAGATC
CCCTTGATCGGCAGGCTGCGATCAGAGGGCGTCCCAATCCAGGGCCTGACCATTGGAGCCGGCGTGCCTTCCATC
GAAGTCGCGCAGGAGTACATTGACACCTTGGGTCTGAAGCACATAGCTTTCAAGCCCGGCTCCGTCGAAGCTATT
CAGGCCGTTATCAACATCGCCAAGGCAAACCCGAGCTTCCCCGTCATTCTTCAGTGGACTGGTGGCCGAGGCGGT
GGTCATCACTCCTATGAGGATTTCCACCAGCCGATGCTGCAGATGTACGGCCGGGTTCGGCGGCAAGACAACATC
GTCCTGGTCGCTGGCAGCGGCTTCGGTGGCGCAGATGACACCTACCCGTACATCACTGGCGACTGGGCCAAGAAG
TACGGCTATCCTCCGATGCCCTTCGACGGCTGCTTGTTCGGGAGTCGCATGATGGTCGCCAGGGAAGCGCACACG
AGCAAGAGCGCGAAGCAGGCCATCGTCGACGCTCCTGGCGTTGGTGATGGTGAGTGGGAGAAGACGTACAAAGGC
CCTGCCGGCGGCGTCATCACGGTGCGATCGGAGATGGGTGAGCCTATCCACAAGCTCGCAACCCGAGGCGTTCGA
TTCTGGGCGGAGATGGACCAGAAGATCTTCAGTTTGCCCAAAGAGAAGAGAGTGGCAGAGCTGAAAAAGAGCCGG
GAGTATATCATCAAGAAGCTCAATGATGACTTCCAGAAGGTTTGGTTCGGCTGCAATAAGTCAGGAAAAGCCGTC
GATTTGGAGGATATGACGTACGCTGAGGTCGTGCGGCGGCTGGTCGAGCTGCTCTATGTCAAGCACCAGTCTCGA
TGGATCGATCCATCGTTCGCGAGACTCACTGGCGATTTCATTCATCGGGTCGAGGAACGTTTCACCACCGCGCCT
GGTCAGCCGTCCAGGCTCCAGAATTACTCGGACTTGGATGAGCCTTTCAGTGCCGTTGACCGGATCCTAGCCCAC
TATCCCGAGGCCGAGACTCAAATCATCAACGCGCAGGACGTTCAGCACGTTTTGCTGCTCTGCATGCGGCGAGGC
CAGAAACCCGTGACGTTCATCCCGGCCCTGGACGAGAATTTTGAGTTTTTCTTCAAGAAGGACTCACTTTGGCAG
TCCGAGGACCTGGATGCCGTCATCGGCCAGGATGTCGGACGGACCTGCATTCTCCAGGGTCCCACGGCTGCCAAG
TTCTCGACCGTCCTTGACGAACCAATCAAGGACATTCTTGATGGCATTCACCACGCTCATATCACTGCACTGACG
CGGGACTACTATAACAACGACGAGCGTTCCATCCCAGCAGTCGAGTACTTCGGTGGGAAGCTGGTGGAGCCAGAG
GTGCCGCTCGACGTCGAAGGACTGACCGTGCACTACGATACTCACAAAAACACCTACCGTCTGTCATCCTCTCCG
ACTGCCGTTCTGCCATCTCTCGATTCGTGGCTGTCTCTTCTGGCGGGTCCCAATCGCAACTGGAGATACGCACTC
CTGATGTCGGATATTGTTGTTCAAGGCCAGAAATTCCAGACAAACCCGATCCGACGCATCTTTGCACCCGTCCGA
GGCTTGTTTGTGGAGATTGAGTTCCCCAACGAGCCGGACAAGACGTCGATTGTGGTCCGCGAGCAGCCGAGACAC
AACCAGTATGTGGATGTCATCGAGGTCAAGTTGACCGGCAAGAACGAGATTCTCGTCAACCTGATTAAAGATACA
ACGGCCCTCGGCAAGCCTGTTGCCATGCCCCTGAAGTTCACCTACCGTCCCGAAGCTGGCTACGCCCCCATCCAT
GAGGTCATGCAGGATCGCAACGATCGCATCAAGGAGTTCTACTGGAAGGCATGGTTCGGCAACGACCCTTTGAAT
CTGGATGCCGTCGTCACGAGCAAGTTCGACGGAGGCCGCACCACCATCACCAGCGAGGCCATCCGAGACTTTGTG
CACGCTGTCGGCAACACGGGCGAGGCCTTTGTCGACCGGCCAGGAAAGACAGTCTACGCACCTATGGACTTTGCC
ATTGTCGTGGGCTGGAAAGCCATCACGAAGCCCATCTTCCCCCGGACCATAGATGGCGACCTTCTCAAGCTCGTC
CACCTGTCGAACCAGTTCCGAATGATTCATGGGGCAGAGCCGCTAAAGAAGGGCGATGAGATCTCCACCACTGCG
CAAATCAACGCTGTCATTAACCAGGACTCGGGTAAGATGGTCGAGGTGTGTGGCACCATCGTAAGAGATGGGAAG
CCCGTGATGGAGGTCACTTCGCAGTTTCTGTATCGCGGGGCTTACTTGGATTACGAGAACACATTCCAGCGCAAG
GTCGAGACTCCCGTCCAGGTCCAATTGGCCACAAGCAAGGACGTGGCTGTGCTCCGGTCCAAGAATTGGTTCGCC
ATTGACGAGGTTCCGAGCGACATCGACTTGCTTGGCCAGACCCTTACCTTTCGGCTGCAGAGCCTTGTGCGATAC
AAGAACAAGAATGTCTTCAGCAGTATCGAGACCCGCGGACAGGTGCTGTTGGAGCTGCCCACGAAGGAGGTAATT
CAGGTTGCGAGTGTCGATTACGAAGCCGGCGAGTCCCACGGCAACCCGGTCATTGACTACTTGGAGCGAAACGGC
TCGCCGCTCGACCAGCCCATCTACTTCGAAAACCCGATCCCCCTGAGCGGTAAAACTCCCCTGCAGCTCCGCGCT
CCAGCCTCAAACGAAACGTATGCTCGCGTCTCTGGAGACTACAACCCCATCCACGTCTCGCGCGTCTTCTCCAGC
TACGCCAACCTCCCCGGAACCATAACCCACGGCATGTACTCCAGCGCTGCTGTCCGAAGCCTCCTCGAGACATGG
GCTGCCGAGAACGACATCGGCCGGGTTCGCAGTTTCCACGCCTCCCTGGTCGGTATGGTACTCCCGAATGACGAC
ATACAGGTAAAGCTGCAACATGTCGGGATGGTTGCCGGGCGCAAAATCATCAAAGTCGAAGTTAACAACACGGAG
ACGGAAGAGAAAGTGCTCCTTGGCGAGGCCGAGATCGAGCAACCGGTGACGGCCTACGTGTTCACCGGCCAGGGA
TCGCAAGAGCAGGGCATGGGTATGGAGCTATACGCGAGCAGCGCCGTCGCCAAGGAAGTCTGGGATCGTGCGGAT
CATTATCTTCTTGACAACTACGGCTTCTCCATCACGAACATTGTCAAGAACAACCCCAAGGAGCTTACCATTCAC
TTTGGTGGACCGAGAGGCAAAGCCATCAGGCATAACTACATGTCCATGACATTCGAGACAGTTGCCACCGACGGG
TCCATCAAGTCGGAGCGCATCTTCAAAGAGATCAACGAAGGCACCACCTGTTACACGTACCGTTCGCCAACCGGC
CTGCTCTCGGCCACGCAGTTTACGCAGCCTGCGCTGACGCTCATGGAGAAGGCCAGCTTCGAAGACATGAAAGCC
CGGGGTCTCGTGCCCAGGGACAGCACGTTTGCCGGCCACTCACTGGGCGAGTACTCGGCGCTGGCCGCGCTGGCC
GACGTGATGCCGATCGAGTCTCTCGTCTCCGTCGTCTTCTACCGGGGTCTGACCATGCAGGTGGCTGTCGAGCGG
GATGCCAGCGGGCGCTCCAACTATTCGATGTGCGCTGTGAACCCGAGCCGCATATCGAAGACGTTCAACGAAGAG
GCATTGCAGTTTGTCGTGAACAACATTGCGGAGGAGACGGGCTGGCTTTTGGAGATTGTCAACTACAACATTGCC
AACATGCAGTACGTGTGTGCGGGCGACTTGAGGGCGCTCGACACACTTGCTGGGGTGACGAACTTCGTCAAGAAG
CAGCAAATCGATATTGAGGAGATGAGAAGCAACATCGAGGAGGCCAAGGGGGCGCTGCGCGAGATCATCCGCGGA
TGCGCGGAAGCAACGCTGAAGAAGCCGCAGCCGCTGGAACTGGAGCGGGGTTTCGCGACAATCCCCCTGCGAGGC
ATCGACGTACCCTTCCACTCGACCTTTTTGAGGTCGGGTGTCAAGCCTTTCCGATCATTCCTGCTCAAGAAGATC
AACAAGACGACGATTGACCCGTCGAAGTTGGTCGGGAAGTACATTCCGAACGTGACGGCCAAGCCGTTTGCGCTC
ACCAAGGACTACTTCGAGGAGGTGTACAAGTTGACTAACTCGCCCAAGATCGGTGCCGTCTTGGCAAACTGGGAC
AAGTACGCCCAGGATGACGACGGCAGGGCCGGCAGCGAAAGTGGTTCGAGCGTCGAGTACGAGGGTCCCGGCGCA
GCTGCTTGA
Transcript >Hirsu2|5043
ATGTACGGGACGGGAACCGGCCCCCAGACGGGCATTTCCACCCCCAGATCTAATTCCTCGCTCCGGCCATTGACT
TTGGCCCATGGCTCCCTCGAAACATCGTTCCTCATCCCGACCAATCTCCATTTCCATGCCTCGCAGCTGAAAGAC
CGCTTCGTGGCTTCTCTGCCCACGGCCACCGACGAGCTTGCCCAGGATGACGAGCCTTCATCCGTACCCGAGCTG
GTTGCCAGATACCTGGGATTCGTGGCCCGCGAGGTGGAAGAGGGTGAGGATGACGCGCAAGGCTCATACGAGGAA
GTGCTCAAGCTCGTCCTCAACGAGTTTGAGAGAGCTTTCCTGCGCGGCAACGAGGTCCACGCCGTGGCCGCCACC
CTCCCGGGCATCGAGTCCAAGAAGCTCGAGGTGATTCGCAGCTACTACCTCGCCCGCGCTGTTTCCAACAGGACC
ATCAAACCACACGAGTCGGCCCTGCTGCGCGCTTCCGACGATGGCTCCGCTGAGATCTTTACCATCTTCGGCGGT
CAGGGCAACATTGAGGAGTACTTCGAGGAGCTTCGCGAGGTTTTCCGGACATACCCGAGCTTTGTCGGCGAGCTC
ATCACCTCCGCTGCCGAACAACTCCAGACGCTGTCCAACCACCCCAGCGCCGAAAAGATGTTCCCCAAGGGGCTC
GACATCATGAACTGGCTGCAGCACCCGGACTCTACCCCGGATGTCGACTACCTGATCTCGGCACCCGTCAGCTTT
CCCCTGATTGGGCTGGTTCAGATGACGCATTACGAGGTCACTTGCAAGGTGCTCGGCATCGACCCCGGCCAGCTG
CGGGAGCGCATCAGCGGCACTACCGGTCACTCCCAGGGCATCGTCATGGCCGCCGCCACTGCTGCCGCCGACTCC
TGGGACTCGTGGCGGGACATTGTGAGCTCGACTCTGGCGATCCTGTTCTGGATCGGAACACGAAGCCAGCAGGCG
TTCCCCACCACGTCCATGACGCCCACCATGCTGCGCGAGTCCATGGACCACGGCGAGGGCACGCCAACGCCTATG
CTCAGCATCCGAGATTTATCACAGCAGGAGGTCCAGAAGCATATCGATGCTACCAATCAATACCTTCCGCCGGAC
CGCCACATCAGTGTATCGCTCATCAATAGCCCGCGCAACCTTGTTGTCACGGGGCCACCTACCTCTCTCTACGGC
CTCAACTCGCAGCTGCGTAAAGTCAAGGCTCCCACGGGTCTTGATCAAAATCGTGTGCCATACACCGAGCGCAAG
ATCCGCTTCGTGAACCGATTCCTCCCCATCACTGCTCCATTTCACAGCAAATACCTCTCAGAGGCGACTGCTATG
ATCGACGAGGACCTCAAGGACGTCAGCATCGAGTCCGGCTCCCTGGGGATCCCCGTCTTCGACACAAATACGGGC
AAGAACCTCCGCTCTGAGACCGGTGGTAACATTGTCCCTGCCCTGGTCCGCCTGATCACCCGTGATCCTGTCAAC
TGGGAGAAGGCAACTGTCTTCGGCAAAGCAACACACATCCTCGACTTTGGCCCCGGCGGCGTGTCCGGTCTCGGT
GTCCTGACGAGCCGAAACAAGGAAGGAACCGGAGTCCGTGTGATTCTCGCCGGCACTGTGGATGGCACCATCACG
GAGGTCGGCTACAAGCCGGAGCTCTTCGATAGGGACGAAGATAATGCCATCAGGTATGCCATAGACTGGGTCAAG
GAGTTTGCTCCCAGATTAGTGAAGACGTCAAGCGGGCAGAAATATGTCGACACAAGGATGAGCCGTCTCCTCGGC
CTGCCCCCTGTCATGGTCGCCGCCATGGCTCCCGCCACGGCTCCCTGGGACTTTGTCGCCGCCACCATGAATGCG
GGATATCACATCGAACTCGCCGGTGGTGCCTACTTCAATGCGAAGAAGATGACGGACGCCCTTTCTAAAATCGAA
AAGGCAATTCCTGCGGGTCGCGGCATCTCCGTCAATCTTATTTACGTGAACCCGCGAGCTATGGCGTGGCAGATC
CCCTTGATCGGCAGGCTGCGATCAGAGGGCGTCCCAATCCAGGGCCTGACCATTGGAGCCGGCGTGCCTTCCATC
GAAGTCGCGCAGGAGTACATTGACACCTTGGGTCTGAAGCACATAGCTTTCAAGCCCGGCTCCGTCGAAGCTATT
CAGGCCGTTATCAACATCGCCAAGGCAAACCCGAGCTTCCCCGTCATTCTTCAGTGGACTGGTGGCCGAGGCGGT
GGTCATCACTCCTATGAGGATTTCCACCAGCCGATGCTGCAGATGTACGGCCGGGTTCGGCGGCAAGACAACATC
GTCCTGGTCGCTGGCAGCGGCTTCGGTGGCGCAGATGACACCTACCCGTACATCACTGGCGACTGGGCCAAGAAG
TACGGCTATCCTCCGATGCCCTTCGACGGCTGCTTGTTCGGGAGTCGCATGATGGTCGCCAGGGAAGCGCACACG
AGCAAGAGCGCGAAGCAGGCCATCGTCGACGCTCCTGGCGTTGGTGATGGTGAGTGGGAGAAGACGTACAAAGGC
CCTGCCGGCGGCGTCATCACGGTGCGATCGGAGATGGGTGAGCCTATCCACAAGCTCGCAACCCGAGGCGTTCGA
TTCTGGGCGGAGATGGACCAGAAGATCTTCAGTTTGCCCAAAGAGAAGAGAGTGGCAGAGCTGAAAAAGAGCCGG
GAGTATATCATCAAGAAGCTCAATGATGACTTCCAGAAGGTTTGGTTCGGCTGCAATAAGTCAGGAAAAGCCGTC
GATTTGGAGGATATGACGTACGCTGAGGTCGTGCGGCGGCTGGTCGAGCTGCTCTATGTCAAGCACCAGTCTCGA
TGGATCGATCCATCGTTCGCGAGACTCACTGGCGATTTCATTCATCGGGTCGAGGAACGTTTCACCACCGCGCCT
GGTCAGCCGTCCAGGCTCCAGAATTACTCGGACTTGGATGAGCCTTTCAGTGCCGTTGACCGGATCCTAGCCCAC
TATCCCGAGGCCGAGACTCAAATCATCAACGCGCAGGACGTTCAGCACGTTTTGCTGCTCTGCATGCGGCGAGGC
CAGAAACCCGTGACGTTCATCCCGGCCCTGGACGAGAATTTTGAGTTTTTCTTCAAGAAGGACTCACTTTGGCAG
TCCGAGGACCTGGATGCCGTCATCGGCCAGGATGTCGGACGGACCTGCATTCTCCAGGGTCCCACGGCTGCCAAG
TTCTCGACCGTCCTTGACGAACCAATCAAGGACATTCTTGATGGCATTCACCACGCTCATATCACTGCACTGACG
CGGGACTACTATAACAACGACGAGCGTTCCATCCCAGCAGTCGAGTACTTCGGTGGGAAGCTGGTGGAGCCAGAG
GTGCCGCTCGACGTCGAAGGACTGACCGTGCACTACGATACTCACAAAAACACCTACCGTCTGTCATCCTCTCCG
ACTGCCGTTCTGCCATCTCTCGATTCGTGGCTGTCTCTTCTGGCGGGTCCCAATCGCAACTGGAGATACGCACTC
CTGATGTCGGATATTGTTGTTCAAGGCCAGAAATTCCAGACAAACCCGATCCGACGCATCTTTGCACCCGTCCGA
GGCTTGTTTGTGGAGATTGAGTTCCCCAACGAGCCGGACAAGACGTCGATTGTGGTCCGCGAGCAGCCGAGACAC
AACCAGTATGTGGATGTCATCGAGGTCAAGTTGACCGGCAAGAACGAGATTCTCGTCAACCTGATTAAAGATACA
ACGGCCCTCGGCAAGCCTGTTGCCATGCCCCTGAAGTTCACCTACCGTCCCGAAGCTGGCTACGCCCCCATCCAT
GAGGTCATGCAGGATCGCAACGATCGCATCAAGGAGTTCTACTGGAAGGCATGGTTCGGCAACGACCCTTTGAAT
CTGGATGCCGTCGTCACGAGCAAGTTCGACGGAGGCCGCACCACCATCACCAGCGAGGCCATCCGAGACTTTGTG
CACGCTGTCGGCAACACGGGCGAGGCCTTTGTCGACCGGCCAGGAAAGACAGTCTACGCACCTATGGACTTTGCC
ATTGTCGTGGGCTGGAAAGCCATCACGAAGCCCATCTTCCCCCGGACCATAGATGGCGACCTTCTCAAGCTCGTC
CACCTGTCGAACCAGTTCCGAATGATTCATGGGGCAGAGCCGCTAAAGAAGGGCGATGAGATCTCCACCACTGCG
CAAATCAACGCTGTCATTAACCAGGACTCGGGTAAGATGGTCGAGGTGTGTGGCACCATCGTAAGAGATGGGAAG
CCCGTGATGGAGGTCACTTCGCAGTTTCTGTATCGCGGGGCTTACTTGGATTACGAGAACACATTCCAGCGCAAG
GTCGAGACTCCCGTCCAGGTCCAATTGGCCACAAGCAAGGACGTGGCTGTGCTCCGGTCCAAGAATTGGTTCGCC
ATTGACGAGGTTCCGAGCGACATCGACTTGCTTGGCCAGACCCTTACCTTTCGGCTGCAGAGCCTTGTGCGATAC
AAGAACAAGAATGTCTTCAGCAGTATCGAGACCCGCGGACAGGTGCTGTTGGAGCTGCCCACGAAGGAGGTAATT
CAGGTTGCGAGTGTCGATTACGAAGCCGGCGAGTCCCACGGCAACCCGGTCATTGACTACTTGGAGCGAAACGGC
TCGCCGCTCGACCAGCCCATCTACTTCGAAAACCCGATCCCCCTGAGCGGTAAAACTCCCCTGCAGCTCCGCGCT
CCAGCCTCAAACGAAACGTATGCTCGCGTCTCTGGAGACTACAACCCCATCCACGTCTCGCGCGTCTTCTCCAGC
TACGCCAACCTCCCCGGAACCATAACCCACGGCATGTACTCCAGCGCTGCTGTCCGAAGCCTCCTCGAGACATGG
GCTGCCGAGAACGACATCGGCCGGGTTCGCAGTTTCCACGCCTCCCTGGTCGGTATGGTACTCCCGAATGACGAC
ATACAGGTAAAGCTGCAACATGTCGGGATGGTTGCCGGGCGCAAAATCATCAAAGTCGAAGTTAACAACACGGAG
ACGGAAGAGAAAGTGCTCCTTGGCGAGGCCGAGATCGAGCAACCGGTGACGGCCTACGTGTTCACCGGCCAGGGA
TCGCAAGAGCAGGGCATGGGTATGGAGCTATACGCGAGCAGCGCCGTCGCCAAGGAAGTCTGGGATCGTGCGGAT
CATTATCTTCTTGACAACTACGGCTTCTCCATCACGAACATTGTCAAGAACAACCCCAAGGAGCTTACCATTCAC
TTTGGTGGACCGAGAGGCAAAGCCATCAGGCATAACTACATGTCCATGACATTCGAGACAGTTGCCACCGACGGG
TCCATCAAGTCGGAGCGCATCTTCAAAGAGATCAACGAAGGCACCACCTGTTACACGTACCGTTCGCCAACCGGC
CTGCTCTCGGCCACGCAGTTTACGCAGCCTGCGCTGACGCTCATGGAGAAGGCCAGCTTCGAAGACATGAAAGCC
CGGGGTCTCGTGCCCAGGGACAGCACGTTTGCCGGCCACTCACTGGGCGAGTACTCGGCGCTGGCCGCGCTGGCC
GACGTGATGCCGATCGAGTCTCTCGTCTCCGTCGTCTTCTACCGGGGTCTGACCATGCAGGTGGCTGTCGAGCGG
GATGCCAGCGGGCGCTCCAACTATTCGATGTGCGCTGTGAACCCGAGCCGCATATCGAAGACGTTCAACGAAGAG
GCATTGCAGTTTGTCGTGAACAACATTGCGGAGGAGACGGGCTGGCTTTTGGAGATTGTCAACTACAACATTGCC
AACATGCAGTACGTGTGTGCGGGCGACTTGAGGGCGCTCGACACACTTGCTGGGGTGACGAACTTCGTCAAGAAG
CAGCAAATCGATATTGAGGAGATGAGAAGCAACATCGAGGAGGCCAAGGGGGCGCTGCGCGAGATCATCCGCGGA
TGCGCGGAAGCAACGCTGAAGAAGCCGCAGCCGCTGGAACTGGAGCGGGGTTTCGCGACAATCCCCCTGCGAGGC
ATCGACGTACCCTTCCACTCGACCTTTTTGAGGTCGGGTGTCAAGCCTTTCCGATCATTCCTGCTCAAGAAGATC
AACAAGACGACGATTGACCCGTCGAAGTTGGTCGGGAAGTACATTCCGAACGTGACGGCCAAGCCGTTTGCGCTC
ACCAAGGACTACTTCGAGGAGGTGTACAAGTTGACTAACTCGCCCAAGATCGGTGCCGTCTTGGCAAACTGGGAC
AAGTACGCCCAGGATGACGACGGCAGGGCCGGCAGCGAAAGTGGTTCGAGCGTCGAGTACGAGGGTCCCGGCGCA
GCTGCTTGA
Gene >Hirsu2|5043
ATGTACGGGACGGGAACCGGCCCCCAGACGGGCATTTCCACCCCCAGATCTAATTCCTCGCTCCGGCCATTGACT
TTGGCCCATGGCTCCCTCGAAACATCGTTCCTCATCCCGACCAATCTCCATTTCCATGCCTCGCAGCTGAAAGAC
CGCTTCGTGGCTTCTCTGCCCACGGCCACCGACGAGCTTGCCCAGGATGACGAGCCTTCATCCGTACCCGAGCTG
GTTGCCAGATACCTGGGATTCGTGGCCCGCGAGGTGGAAGAGGGTGAGGATGACGCGCAAGGCTCATACGAGGAA
GTGCTCAAGCTCGTCCTCAACGAGTTTGAGAGAGCTTTCCTGCGCGGCAACGAGGTCCACGCCGTGGCCGCCACC
CTCCCGGGCATCGAGTCCAAGAAGCTCGAGGTGATTCGCAGCTACTACCTCGCCCGCGCTGTTTCCAACAGGACC
ATCAAACCACACGAGTCGGCCCTGCTGCGCGCTTCCGACGATGGCTCCGCTGAGATCTTTACCATCTTCGGCGGT
CAGGGCAACATTGAGGAGTACTTCGAGGAGCTTCGCGAGGTTTTCCGGACATACCCGAGCTTTGTCGGCGAGCTC
ATCACCTCCGCTGCCGAACAACTCCAGACGCTGTCCAACCACCCCAGCGCCGAAAAGATGTTCCCCAAGGGGCTC
GACATCATGAACTGGCTGCAGCACCCGGACTCTACCCCGGATGTCGACTACCTGATCTCGGCACCCGTCAGCTTT
CCCCTGATTGGGCTGGTTCAGATGACGCATTACGAGGTCACTTGCAAGGTGCTCGGCATCGACCCCGGCCAGCTG
CGGGAGCGCATCAGCGGCACTACCGGTCACTCCCAGGGCATCGTCATGGCCGCCGCCACTGCTGCCGCCGACTCC
TGGGACTCGTGGCGGGACATTGTGAGCTCGACTCTGGCGATCCTGTTCTGGATCGGAACACGAAGCCAGCAGGCG
TTCCCCACCACGTCCATGACGCCCACCATGCTGCGCGAGTCCATGGACCACGGCGAGGGCACGCCAACGCCTATG
CTCAGCATCCGAGATTTATCACAGCAGGAGGTCCAGAAGCATATCGATGCTACCAATCAATACCTTCCGCCGGAC
CGCCACATCAGTGTATCGCTCATCAATAGCCCGCGCAACCTTGTTGTCACGGGGCCACCTACCTCTCTCTACGGC
CTCAACTCGCAGCTGCGTAAAGTCAAGGCTCCCACGGGTCTTGATCAAAATCGTGTGCCATACACCGAGCGCAAG
ATCCGCTTCGTGAACCGATTCCTCCCCATCACTGCTCCATTTCACAGCAAATACCTCTCAGAGGCGACTGCTATG
ATCGACGAGGACCTCAAGGACGTCAGCATCGAGTCCGGCTCCCTGGGGATCCCCGTCTTCGACACAAATACGGGC
AAGAACCTCCGCTCTGAGACCGGTGGTAACATTGTCCCTGCCCTGGTCCGCCTGATCACCCGTGATCCTGTCAAC
TGGGAGAAGGCAACTGTCTTCGGCAAAGCAACACACATCCTCGACTTTGGCCCCGGCGGCGTGTCCGGTCTCGGT
GTCCTGACGAGCCGAAACAAGGAAGGAACCGGAGTCCGTGTGATTCTCGCCGGCACTGTGGATGGCACCATCACG
GAGGTCGGCTACAAGCCGGAGCTCTTCGATAGGGACGAAGATAATGCCATCAGGTATGCCATAGACTGGGTCAAG
GAGTTTGCTCCCAGATTAGTGAAGACGTCAAGCGGGCAGAAATATGTCGACACAAGGATGAGCCGTCTCCTCGGC
CTGCCCCCTGTCATGGTCGCCGCCATGGCTCCCGCCACGGCTCCCTGGGACTTTGTCGCCGCCACCATGAATGCG
GGATATCACATCGAACTCGCCGGTGGTGCCTACTTCAATGCGAAGAAGATGACGGACGCCCTTTCTAAAATCGAA
AAGGCAATTCCTGCGGGTCGCGGCATCTCCGTCAATCTTATTTACGTGAACCCGCGAGCTATGGCGTGGCAGATC
CCCTTGATCGGCAGGCTGCGATCAGAGGGCGTCCCAATCCAGGGCCTGACCATTGGAGCCGGCGTGCCTTCCATC
GAAGTCGCGCAGGAGTACATTGACACCTTGGGTCTGAAGCACATAGCTTTCAAGCCCGGCTCCGTCGAAGCTATT
CAGGCCGTTATCAACATCGCCAAGGCAAACCCGAGCTTCCCCGTCATTCTTCAGTGGACTGGTGGCCGAGGCGGT
GGTCATCACTCCTATGAGGATTTCCACCAGCCGATGCTGCAGATGTACGGCCGGGTTCGGCGGCAAGACAACATC
GTCCTGGTCGCTGGCAGCGGCTTCGGTGGCGCAGATGACACCTACCCGTACATCACTGGCGACTGGGCCAAGAAG
TACGGCTATCCTCCGATGCCCTTCGACGGCTGCTTGTTCGGGAGTCGCATGATGGTCGCCAGGGAAGCGCACACG
AGCAAGAGCGCGAAGCAGGCCATCGTCGACGCTCCTGGCGTTGGTGATGGTGAGTGGGAGAAGACGTACAAAGGC
CCTGCCGGCGGCGTCATCACGGTGCGATCGGAGATGGGTGAGCCTATCCACAAGCTCGCAACCCGAGGCGTTCGA
TTCTGGGCGGAGATGGACCAGAAGATCTTCAGTTTGCCCAAAGAGAAGAGAGTGGCAGAGCTGAAAAAGAGCCGG
GAGTATATCATCAAGAAGCTCAATGATGACTTCCAGAAGGTTTGGTTCGGCTGCAATAAGTCAGGAAAAGCCGTC
GATTTGGAGGATATGACGTACGCTGAGGTCGTGCGGCGGCTGGTCGAGCTGCTCTATGTCAAGCACCAGTCTCGA
TGGATCGATCCATCGTTCGCGAGACTCACTGGCGATTTCATTCATCGGGTCGAGGAACGTTTCACCACCGCGCCT
GGTCAGCCGTCCAGGCTCCAGAATTACTCGGACTTGGATGAGCCTTTCAGTGCCGTTGACCGGATCCTAGCCCAC
TATCCCGAGGCCGAGACTCAAATCATCAACGCGCAGGACGTTCAGCACGTTTTGCTGCTCTGCATGCGGCGAGGC
CAGAAACCCGTGACGTTCATCCCGGCCCTGGACGAGAATTTTGAGTTTTTCTTCAAGAAGGACTCACTTTGGCAG
TCCGAGGACCTGGATGCCGTCATCGGCCAGGATGTCGGACGGACCTGCATTCTCCAGGGTCCCACGGCTGCCAAG
TTCTCGACCGTCCTTGACGAACCAATCAAGGACATTCTTGATGGCATTCACCACGCTCATATCACTGCACTGACG
CGGGACTACTATAACAACGACGAGCGTTCCATCCCAGCAGTCGAGTACTTCGGTGGGAAGCTGGTGGAGCCAGAG
GTGCCGCTCGACGTCGAAGGACTGACCGTGCACTACGATACTCACAAAAACACCTACCGTCTGTCATCCTCTCCG
ACTGCCGTTCTGCCATCTCTCGATTCGTGGCTGTCTCTTCTGGCGGGTCCCAATCGCAACTGGAGATACGCACTC
CTGATGTCGGATATTGTTGTTCAAGGCCAGAAATTCCAGACAAACCCGATCCGACGCATCTTTGCACCCGTCCGA
GGCTTGTTTGTGGAGATTGAGTTCCCCAACGAGCCGGACAAGACGTCGATTGTGGTCCGCGAGCAGCCGAGACAC
AACCAGTATGTGGATGTCATCGAGGTCAAGTTGACCGGCAAGAACGAGATTCTCGTCAACCTGATTAAAGATACA
ACGGCCCTCGGCAAGCCTGTTGCCATGCCCCTGAAGTTCACCTACCGTCCCGAAGCTGGCTACGCCCCCATCCAT
GAGGTCATGCAGGATCGCAACGATCGCATCAAGGAGTTCTACTGGAAGGCATGGTTCGGCAACGACCCTTTGAAT
CTGGATGCCGTCGTCACGAGCAAGTTCGACGGAGGCCGCACCACCATCACCAGCGAGGCCATCCGAGACTTTGTG
CACGCTGTCGGCAACACGGGCGAGGCCTTTGTCGACCGGCCAGGAAAGACAGTCTACGCACCTATGGACTTTGCC
ATTGTCGTGGGCTGGAAAGCCATCACGAAGCCCATCTTCCCCCGGACCATAGATGGCGACCTTCTCAAGCTCGTC
CACCTGTCGAACCAGTTCCGAATGATTCATGGGGCAGAGCCGCTAAAGAAGGGCGATGAGATCTCCACCACTGCG
CAAATCAACGCTGTCATTAACCAGGACTCGGGTAAGATGGTCGAGGTGTGTGGCACCATCGTAAGAGATGGGAAG
CCCGTGATGGAGGTCACTTCGCAGTTTCTGTATCGCGGGGCTTACTTGGATTACGAGAACACATTCCAGCGCAAG
GTCGAGACTCCCGTCCAGGTCCAATTGGCCACAAGCAAGGACGTGGCTGTGCTCCGGTCCAAGAATTGGTTCGCC
ATTGACGAGGTTCCGAGCGACATCGACTTGCTTGGCCAGACCCTTACCTTTCGGCTGCAGAGCCTTGTGCGATAC
AAGAACAAGAATGTCTTCAGCAGTATCGAGACCCGCGGACAGGTGCTGTTGGAGCTGCCCACGAAGGAGGTAATT
CAGGTTGCGAGTGTCGATTACGAAGCCGGCGAGTCCCACGGCAACCCGGTCATTGACTACTTGGAGCGAAACGGC
TCGCCGCTCGACCAGCCCATCTACTTCGAAAACCCGATCCCCCTGAGCGGTAAAACTCCCCTGCAGCTCCGCGCT
CCAGCCTCAAACGAAACGTATGCTCGCGTCTCTGGAGACTACAACCCCATCCACGTCTCGCGCGTCTTCTCCAGC
TACGCCAACCTCCCCGGAACCATAACCCACGGCATGTACTCCAGCGCTGCTGTCCGAAGCCTCCTCGAGACATGG
GCTGCCGAGAACGACATCGGCCGGGTTCGCAGTTTCCACGCCTCCCTGGTCGGTATGGTACTCCCGAATGACGAC
ATACAGGTAAAGCTGCAACATGTCGGGATGGTTGCCGGGCGCAAAATCATCAAAGTCGAAGTTAACAACACGGAG
ACGGAAGAGAAAGTGCTCCTTGGCGAGGCCGAGATCGAGCAACCGGTGACGGCCTACGTGTTCACCGGCCAGGGA
TCGCAAGAGCAGGGCATGGGTATGGAGCTATACGCGAGCAGCGCCGTCGCCAAGGAAGTCTGGGATCGTGCGGAT
CATTATCTTCTTGACAACTACGGTAAGCCGTGTGGCGGCCAGAATCCGCCATGCATCATCCGTGTCAAAACAGGA
ATCAAAATCAAGAAATGGCTGACGTCTTTTTTTCCGTCCAGGCTTCTCCATCACGAACATTGTCAAGAACAACCC
CAAGGAGCTTACCATTCACTTTGGTGGACCGAGAGGCAAAGCCATCAGGCATAACTACATGTCCATGACATTCGA
GACAGTTGCCACCGACGGGTCCATCAAGTCGGAGCGCATCTTCAAAGAGATCAACGAAGGCACCACCTGTTACAC
GTACCGTTCGCCAACCGGCCTGCTCTCGGCCACGCAGTTTACGCAGCCTGCGCTGACGCTCATGGAGAAGGCCAG
CTTCGAAGACATGAAAGCCCGGGGTCTCGTGCCCAGGGACAGCACGTTTGCCGGCCACTCACTGGGCGAGTACTC
GGCGCTGGCCGCGCTGGCCGACGTGATGCCGATCGAGTCTCTCGTCTCCGTCGTCTTCTACCGGGGTCTGACCAT
GCAGGTGGCTGTCGAGCGGGATGCCAGCGGGCGCTCCAACTATTCGATGTGCGCTGTGAACCCGAGCCGCATATC
GAAGACGTTCAACGAAGAGGCATTGCAGTTTGTCGTGAACAACATTGCGGAGGAGACGGGCTGGCTTTTGGAGAT
TGTCAACTACAACATTGCCAACATGCAGTACGTGTGTGCGGGCGACTTGAGGGCGCTCGACACACTTGCTGGGGT
GACGAACTTCGTCAAGAAGCAGCAAATCGATATTGAGGAGATGAGAAGCAACATCGAGGAGGCCAAGGGGGCGCT
GCGCGAGATCATCCGCGGATGCGCGGAAGCAACGCTGAAGAAGCCGCAGCCGCTGGAACTGGAGCGGGGTTTCGC
GACAATCCCCCTGCGAGGCATCGACGTACCCTTCCACTCGACCTTTTTGAGGTCGGGTGTCAAGCCTTTCCGATC
ATTCCTGCTCAAGAAGATCAACAAGACGACGATTGACCCGTCGAAGTTGGTCGGGAAGTACATTCCGAACGTGAC
GGCCAAGCCGTTTGCGCTCACCAAGGACTACTTCGAGGAGGTGTACAAGTTGACTAACTCGCCCAAGATCGGTGC
CGTCTTGGCAAACTGGGACAAGTACGCCCAGGATGACGACGGCAGGGCCGGCAGCGAAAGTGGTTCGAGCGTCGA
GTACGAGGGTCCCGGCGCAGCTGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail