Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5043
Gene name
LocationContig_253:4855..11258
Strand-
Gene length (bp)6403
Transcript length (bp)6309
Coding sequence length (bp)6309
Protein length (aa) 2103

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08354 DUF1729 Domain of unknown function (DUF1729) 2.0E-159 739 1088
PF00698 Acyl_transf_1 Acyl transferase domain 6.3E-86 1694 2064
PF17951 FAS_meander Fatty acid synthase meander beta sheet domain 4.3E-52 1153 1296
PF17828 FAS_N N-terminal domain in fatty acid synthase subunit beta 1.3E-37 20 146
PF01575 MaoC_dehydratas MaoC like domain 6.3E-37 1550 1678
PF16073 SAT Starter unit:ACP transacylase in aflatoxin biosynthesis 8.8E-35 172 424
PF13452 MaoC_dehydrat_N N-terminal half of MaoC dehydratase 8.7E-27 1304 1429

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P34229|FAS1_YARLI Fatty acid synthase subunit beta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FAS1 PE=3 SV=2 8 2077 0.0E+00
sp|P34731|FAS1_CANAX Fatty acid synthase subunit beta OS=Candida albicans GN=FAS1 PE=3 SV=1 19 2077 0.0E+00
sp|Q92215|TOXC_COCCA Putative fatty acid synthase subunit TOXC OS=Cochliobolus carbonum GN=TOXC PE=3 SV=1 20 2081 0.0E+00
sp|P07149|FAS1_YEAST Fatty acid synthase subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAS1 PE=1 SV=2 20 2079 0.0E+00
sp|Q9UUG0|FAS1_SCHPO Fatty acid synthase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fas1 PE=1 SV=1 18 2077 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P34229|FAS1_YARLI Fatty acid synthase subunit beta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FAS1 PE=3 SV=2 8 2077 0.0E+00
sp|P34731|FAS1_CANAX Fatty acid synthase subunit beta OS=Candida albicans GN=FAS1 PE=3 SV=1 19 2077 0.0E+00
sp|Q92215|TOXC_COCCA Putative fatty acid synthase subunit TOXC OS=Cochliobolus carbonum GN=TOXC PE=3 SV=1 20 2081 0.0E+00
sp|P07149|FAS1_YEAST Fatty acid synthase subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAS1 PE=1 SV=2 20 2079 0.0E+00
sp|Q9UUG0|FAS1_SCHPO Fatty acid synthase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fas1 PE=1 SV=1 18 2077 0.0E+00
sp|Q00706|STCK_EMENI Putative sterigmatocystin biosynthesis fatty acid synthase subunit beta OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcK PE=3 SV=2 156 2064 0.0E+00
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 1779 2007 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004317 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase activity Yes
GO:0004318 enoyl-[acyl-carrier-protein] reductase (NADH) activity Yes
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors No
GO:0016491 oxidoreductase activity No
GO:0016740 transferase activity No
GO:0016628 oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor No
GO:0003824 catalytic activity No
GO:0016746 acyltransferase activity No
GO:0016829 lyase activity No
GO:0004312 fatty acid synthase activity No
GO:0019171 3-hydroxyacyl-[acyl-carrier-protein] dehydratase activity No
GO:0016835 carbon-oxygen lyase activity No
GO:0003674 molecular_function No
GO:0016836 hydro-lyase activity No
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5781 0.4156 0.1551 0.0487 0.407 0.0818 0.2706 0.1879 0.0973 0.0262

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5329
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7163
Ophiocordyceps australis map64 (Brazil) OphauB2|4244
Ophiocordyceps camponoti-floridani Ophcf2|04211
Ophiocordyceps camponoti-rufipedis Ophun1|2239
Ophiocordyceps kimflemingae Ophio5|8013
Ophiocordyceps subramaniannii Hirsu2|5043 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5043
MYGTGTGPQTGISTPRSNSSLRPLTLAHGSLETSFLIPTNLHFHASQLKDRFVASLPTATDELAQDDEPSSVPEL
VARYLGFVAREVEEGEDDAQGSYEEVLKLVLNEFERAFLRGNEVHAVAATLPGIESKKLEVIRSYYLARAVSNRT
IKPHESALLRASDDGSAEIFTIFGGQGNIEEYFEELREVFRTYPSFVGELITSAAEQLQTLSNHPSAEKMFPKGL
DIMNWLQHPDSTPDVDYLISAPVSFPLIGLVQMTHYEVTCKVLGIDPGQLRERISGTTGHSQGIVMAAATAAADS
WDSWRDIVSSTLAILFWIGTRSQQAFPTTSMTPTMLRESMDHGEGTPTPMLSIRDLSQQEVQKHIDATNQYLPPD
RHISVSLINSPRNLVVTGPPTSLYGLNSQLRKVKAPTGLDQNRVPYTERKIRFVNRFLPITAPFHSKYLSEATAM
IDEDLKDVSIESGSLGIPVFDTNTGKNLRSETGGNIVPALVRLITRDPVNWEKATVFGKATHILDFGPGGVSGLG
VLTSRNKEGTGVRVILAGTVDGTITEVGYKPELFDRDEDNAIRYAIDWVKEFAPRLVKTSSGQKYVDTRMSRLLG
LPPVMVAAMAPATAPWDFVAATMNAGYHIELAGGAYFNAKKMTDALSKIEKAIPAGRGISVNLIYVNPRAMAWQI
PLIGRLRSEGVPIQGLTIGAGVPSIEVAQEYIDTLGLKHIAFKPGSVEAIQAVINIAKANPSFPVILQWTGGRGG
GHHSYEDFHQPMLQMYGRVRRQDNIVLVAGSGFGGADDTYPYITGDWAKKYGYPPMPFDGCLFGSRMMVAREAHT
SKSAKQAIVDAPGVGDGEWEKTYKGPAGGVITVRSEMGEPIHKLATRGVRFWAEMDQKIFSLPKEKRVAELKKSR
EYIIKKLNDDFQKVWFGCNKSGKAVDLEDMTYAEVVRRLVELLYVKHQSRWIDPSFARLTGDFIHRVEERFTTAP
GQPSRLQNYSDLDEPFSAVDRILAHYPEAETQIINAQDVQHVLLLCMRRGQKPVTFIPALDENFEFFFKKDSLWQ
SEDLDAVIGQDVGRTCILQGPTAAKFSTVLDEPIKDILDGIHHAHITALTRDYYNNDERSIPAVEYFGGKLVEPE
VPLDVEGLTVHYDTHKNTYRLSSSPTAVLPSLDSWLSLLAGPNRNWRYALLMSDIVVQGQKFQTNPIRRIFAPVR
GLFVEIEFPNEPDKTSIVVREQPRHNQYVDVIEVKLTGKNEILVNLIKDTTALGKPVAMPLKFTYRPEAGYAPIH
EVMQDRNDRIKEFYWKAWFGNDPLNLDAVVTSKFDGGRTTITSEAIRDFVHAVGNTGEAFVDRPGKTVYAPMDFA
IVVGWKAITKPIFPRTIDGDLLKLVHLSNQFRMIHGAEPLKKGDEISTTAQINAVINQDSGKMVEVCGTIVRDGK
PVMEVTSQFLYRGAYLDYENTFQRKVETPVQVQLATSKDVAVLRSKNWFAIDEVPSDIDLLGQTLTFRLQSLVRY
KNKNVFSSIETRGQVLLELPTKEVIQVASVDYEAGESHGNPVIDYLERNGSPLDQPIYFENPIPLSGKTPLQLRA
PASNETYARVSGDYNPIHVSRVFSSYANLPGTITHGMYSSAAVRSLLETWAAENDIGRVRSFHASLVGMVLPNDD
IQVKLQHVGMVAGRKIIKVEVNNTETEEKVLLGEAEIEQPVTAYVFTGQGSQEQGMGMELYASSAVAKEVWDRAD
HYLLDNYGFSITNIVKNNPKELTIHFGGPRGKAIRHNYMSMTFETVATDGSIKSERIFKEINEGTTCYTYRSPTG
LLSATQFTQPALTLMEKASFEDMKARGLVPRDSTFAGHSLGEYSALAALADVMPIESLVSVVFYRGLTMQVAVER
DASGRSNYSMCAVNPSRISKTFNEEALQFVVNNIAEETGWLLEIVNYNIANMQYVCAGDLRALDTLAGVTNFVKK
QQIDIEEMRSNIEEAKGALREIIRGCAEATLKKPQPLELERGFATIPLRGIDVPFHSTFLRSGVKPFRSFLLKKI
NKTTIDPSKLVGKYIPNVTAKPFALTKDYFEEVYKLTNSPKIGAVLANWDKYAQDDDGRAGSESGSSVEYEGPGA
AA*
Coding >Hirsu2|5043
ATGTACGGGACGGGAACCGGCCCCCAGACGGGCATTTCCACCCCCAGATCTAATTCCTCGCTCCGGCCATTGACT
TTGGCCCATGGCTCCCTCGAAACATCGTTCCTCATCCCGACCAATCTCCATTTCCATGCCTCGCAGCTGAAAGAC
CGCTTCGTGGCTTCTCTGCCCACGGCCACCGACGAGCTTGCCCAGGATGACGAGCCTTCATCCGTACCCGAGCTG
GTTGCCAGATACCTGGGATTCGTGGCCCGCGAGGTGGAAGAGGGTGAGGATGACGCGCAAGGCTCATACGAGGAA
GTGCTCAAGCTCGTCCTCAACGAGTTTGAGAGAGCTTTCCTGCGCGGCAACGAGGTCCACGCCGTGGCCGCCACC
CTCCCGGGCATCGAGTCCAAGAAGCTCGAGGTGATTCGCAGCTACTACCTCGCCCGCGCTGTTTCCAACAGGACC
ATCAAACCACACGAGTCGGCCCTGCTGCGCGCTTCCGACGATGGCTCCGCTGAGATCTTTACCATCTTCGGCGGT
CAGGGCAACATTGAGGAGTACTTCGAGGAGCTTCGCGAGGTTTTCCGGACATACCCGAGCTTTGTCGGCGAGCTC
ATCACCTCCGCTGCCGAACAACTCCAGACGCTGTCCAACCACCCCAGCGCCGAAAAGATGTTCCCCAAGGGGCTC
GACATCATGAACTGGCTGCAGCACCCGGACTCTACCCCGGATGTCGACTACCTGATCTCGGCACCCGTCAGCTTT
CCCCTGATTGGGCTGGTTCAGATGACGCATTACGAGGTCACTTGCAAGGTGCTCGGCATCGACCCCGGCCAGCTG
CGGGAGCGCATCAGCGGCACTACCGGTCACTCCCAGGGCATCGTCATGGCCGCCGCCACTGCTGCCGCCGACTCC
TGGGACTCGTGGCGGGACATTGTGAGCTCGACTCTGGCGATCCTGTTCTGGATCGGAACACGAAGCCAGCAGGCG
TTCCCCACCACGTCCATGACGCCCACCATGCTGCGCGAGTCCATGGACCACGGCGAGGGCACGCCAACGCCTATG
CTCAGCATCCGAGATTTATCACAGCAGGAGGTCCAGAAGCATATCGATGCTACCAATCAATACCTTCCGCCGGAC
CGCCACATCAGTGTATCGCTCATCAATAGCCCGCGCAACCTTGTTGTCACGGGGCCACCTACCTCTCTCTACGGC
CTCAACTCGCAGCTGCGTAAAGTCAAGGCTCCCACGGGTCTTGATCAAAATCGTGTGCCATACACCGAGCGCAAG
ATCCGCTTCGTGAACCGATTCCTCCCCATCACTGCTCCATTTCACAGCAAATACCTCTCAGAGGCGACTGCTATG
ATCGACGAGGACCTCAAGGACGTCAGCATCGAGTCCGGCTCCCTGGGGATCCCCGTCTTCGACACAAATACGGGC
AAGAACCTCCGCTCTGAGACCGGTGGTAACATTGTCCCTGCCCTGGTCCGCCTGATCACCCGTGATCCTGTCAAC
TGGGAGAAGGCAACTGTCTTCGGCAAAGCAACACACATCCTCGACTTTGGCCCCGGCGGCGTGTCCGGTCTCGGT
GTCCTGACGAGCCGAAACAAGGAAGGAACCGGAGTCCGTGTGATTCTCGCCGGCACTGTGGATGGCACCATCACG
GAGGTCGGCTACAAGCCGGAGCTCTTCGATAGGGACGAAGATAATGCCATCAGGTATGCCATAGACTGGGTCAAG
GAGTTTGCTCCCAGATTAGTGAAGACGTCAAGCGGGCAGAAATATGTCGACACAAGGATGAGCCGTCTCCTCGGC
CTGCCCCCTGTCATGGTCGCCGCCATGGCTCCCGCCACGGCTCCCTGGGACTTTGTCGCCGCCACCATGAATGCG
GGATATCACATCGAACTCGCCGGTGGTGCCTACTTCAATGCGAAGAAGATGACGGACGCCCTTTCTAAAATCGAA
AAGGCAATTCCTGCGGGTCGCGGCATCTCCGTCAATCTTATTTACGTGAACCCGCGAGCTATGGCGTGGCAGATC
CCCTTGATCGGCAGGCTGCGATCAGAGGGCGTCCCAATCCAGGGCCTGACCATTGGAGCCGGCGTGCCTTCCATC
GAAGTCGCGCAGGAGTACATTGACACCTTGGGTCTGAAGCACATAGCTTTCAAGCCCGGCTCCGTCGAAGCTATT
CAGGCCGTTATCAACATCGCCAAGGCAAACCCGAGCTTCCCCGTCATTCTTCAGTGGACTGGTGGCCGAGGCGGT
GGTCATCACTCCTATGAGGATTTCCACCAGCCGATGCTGCAGATGTACGGCCGGGTTCGGCGGCAAGACAACATC
GTCCTGGTCGCTGGCAGCGGCTTCGGTGGCGCAGATGACACCTACCCGTACATCACTGGCGACTGGGCCAAGAAG
TACGGCTATCCTCCGATGCCCTTCGACGGCTGCTTGTTCGGGAGTCGCATGATGGTCGCCAGGGAAGCGCACACG
AGCAAGAGCGCGAAGCAGGCCATCGTCGACGCTCCTGGCGTTGGTGATGGTGAGTGGGAGAAGACGTACAAAGGC
CCTGCCGGCGGCGTCATCACGGTGCGATCGGAGATGGGTGAGCCTATCCACAAGCTCGCAACCCGAGGCGTTCGA
TTCTGGGCGGAGATGGACCAGAAGATCTTCAGTTTGCCCAAAGAGAAGAGAGTGGCAGAGCTGAAAAAGAGCCGG
GAGTATATCATCAAGAAGCTCAATGATGACTTCCAGAAGGTTTGGTTCGGCTGCAATAAGTCAGGAAAAGCCGTC
GATTTGGAGGATATGACGTACGCTGAGGTCGTGCGGCGGCTGGTCGAGCTGCTCTATGTCAAGCACCAGTCTCGA
TGGATCGATCCATCGTTCGCGAGACTCACTGGCGATTTCATTCATCGGGTCGAGGAACGTTTCACCACCGCGCCT
GGTCAGCCGTCCAGGCTCCAGAATTACTCGGACTTGGATGAGCCTTTCAGTGCCGTTGACCGGATCCTAGCCCAC
TATCCCGAGGCCGAGACTCAAATCATCAACGCGCAGGACGTTCAGCACGTTTTGCTGCTCTGCATGCGGCGAGGC
CAGAAACCCGTGACGTTCATCCCGGCCCTGGACGAGAATTTTGAGTTTTTCTTCAAGAAGGACTCACTTTGGCAG
TCCGAGGACCTGGATGCCGTCATCGGCCAGGATGTCGGACGGACCTGCATTCTCCAGGGTCCCACGGCTGCCAAG
TTCTCGACCGTCCTTGACGAACCAATCAAGGACATTCTTGATGGCATTCACCACGCTCATATCACTGCACTGACG
CGGGACTACTATAACAACGACGAGCGTTCCATCCCAGCAGTCGAGTACTTCGGTGGGAAGCTGGTGGAGCCAGAG
GTGCCGCTCGACGTCGAAGGACTGACCGTGCACTACGATACTCACAAAAACACCTACCGTCTGTCATCCTCTCCG
ACTGCCGTTCTGCCATCTCTCGATTCGTGGCTGTCTCTTCTGGCGGGTCCCAATCGCAACTGGAGATACGCACTC
CTGATGTCGGATATTGTTGTTCAAGGCCAGAAATTCCAGACAAACCCGATCCGACGCATCTTTGCACCCGTCCGA
GGCTTGTTTGTGGAGATTGAGTTCCCCAACGAGCCGGACAAGACGTCGATTGTGGTCCGCGAGCAGCCGAGACAC
AACCAGTATGTGGATGTCATCGAGGTCAAGTTGACCGGCAAGAACGAGATTCTCGTCAACCTGATTAAAGATACA
ACGGCCCTCGGCAAGCCTGTTGCCATGCCCCTGAAGTTCACCTACCGTCCCGAAGCTGGCTACGCCCCCATCCAT
GAGGTCATGCAGGATCGCAACGATCGCATCAAGGAGTTCTACTGGAAGGCATGGTTCGGCAACGACCCTTTGAAT
CTGGATGCCGTCGTCACGAGCAAGTTCGACGGAGGCCGCACCACCATCACCAGCGAGGCCATCCGAGACTTTGTG
CACGCTGTCGGCAACACGGGCGAGGCCTTTGTCGACCGGCCAGGAAAGACAGTCTACGCACCTATGGACTTTGCC
ATTGTCGTGGGCTGGAAAGCCATCACGAAGCCCATCTTCCCCCGGACCATAGATGGCGACCTTCTCAAGCTCGTC
CACCTGTCGAACCAGTTCCGAATGATTCATGGGGCAGAGCCGCTAAAGAAGGGCGATGAGATCTCCACCACTGCG
CAAATCAACGCTGTCATTAACCAGGACTCGGGTAAGATGGTCGAGGTGTGTGGCACCATCGTAAGAGATGGGAAG
CCCGTGATGGAGGTCACTTCGCAGTTTCTGTATCGCGGGGCTTACTTGGATTACGAGAACACATTCCAGCGCAAG
GTCGAGACTCCCGTCCAGGTCCAATTGGCCACAAGCAAGGACGTGGCTGTGCTCCGGTCCAAGAATTGGTTCGCC
ATTGACGAGGTTCCGAGCGACATCGACTTGCTTGGCCAGACCCTTACCTTTCGGCTGCAGAGCCTTGTGCGATAC
AAGAACAAGAATGTCTTCAGCAGTATCGAGACCCGCGGACAGGTGCTGTTGGAGCTGCCCACGAAGGAGGTAATT
CAGGTTGCGAGTGTCGATTACGAAGCCGGCGAGTCCCACGGCAACCCGGTCATTGACTACTTGGAGCGAAACGGC
TCGCCGCTCGACCAGCCCATCTACTTCGAAAACCCGATCCCCCTGAGCGGTAAAACTCCCCTGCAGCTCCGCGCT
CCAGCCTCAAACGAAACGTATGCTCGCGTCTCTGGAGACTACAACCCCATCCACGTCTCGCGCGTCTTCTCCAGC
TACGCCAACCTCCCCGGAACCATAACCCACGGCATGTACTCCAGCGCTGCTGTCCGAAGCCTCCTCGAGACATGG
GCTGCCGAGAACGACATCGGCCGGGTTCGCAGTTTCCACGCCTCCCTGGTCGGTATGGTACTCCCGAATGACGAC
ATACAGGTAAAGCTGCAACATGTCGGGATGGTTGCCGGGCGCAAAATCATCAAAGTCGAAGTTAACAACACGGAG
ACGGAAGAGAAAGTGCTCCTTGGCGAGGCCGAGATCGAGCAACCGGTGACGGCCTACGTGTTCACCGGCCAGGGA
TCGCAAGAGCAGGGCATGGGTATGGAGCTATACGCGAGCAGCGCCGTCGCCAAGGAAGTCTGGGATCGTGCGGAT
CATTATCTTCTTGACAACTACGGCTTCTCCATCACGAACATTGTCAAGAACAACCCCAAGGAGCTTACCATTCAC
TTTGGTGGACCGAGAGGCAAAGCCATCAGGCATAACTACATGTCCATGACATTCGAGACAGTTGCCACCGACGGG
TCCATCAAGTCGGAGCGCATCTTCAAAGAGATCAACGAAGGCACCACCTGTTACACGTACCGTTCGCCAACCGGC
CTGCTCTCGGCCACGCAGTTTACGCAGCCTGCGCTGACGCTCATGGAGAAGGCCAGCTTCGAAGACATGAAAGCC
CGGGGTCTCGTGCCCAGGGACAGCACGTTTGCCGGCCACTCACTGGGCGAGTACTCGGCGCTGGCCGCGCTGGCC
GACGTGATGCCGATCGAGTCTCTCGTCTCCGTCGTCTTCTACCGGGGTCTGACCATGCAGGTGGCTGTCGAGCGG
GATGCCAGCGGGCGCTCCAACTATTCGATGTGCGCTGTGAACCCGAGCCGCATATCGAAGACGTTCAACGAAGAG
GCATTGCAGTTTGTCGTGAACAACATTGCGGAGGAGACGGGCTGGCTTTTGGAGATTGTCAACTACAACATTGCC
AACATGCAGTACGTGTGTGCGGGCGACTTGAGGGCGCTCGACACACTTGCTGGGGTGACGAACTTCGTCAAGAAG
CAGCAAATCGATATTGAGGAGATGAGAAGCAACATCGAGGAGGCCAAGGGGGCGCTGCGCGAGATCATCCGCGGA
TGCGCGGAAGCAACGCTGAAGAAGCCGCAGCCGCTGGAACTGGAGCGGGGTTTCGCGACAATCCCCCTGCGAGGC
ATCGACGTACCCTTCCACTCGACCTTTTTGAGGTCGGGTGTCAAGCCTTTCCGATCATTCCTGCTCAAGAAGATC
AACAAGACGACGATTGACCCGTCGAAGTTGGTCGGGAAGTACATTCCGAACGTGACGGCCAAGCCGTTTGCGCTC
ACCAAGGACTACTTCGAGGAGGTGTACAAGTTGACTAACTCGCCCAAGATCGGTGCCGTCTTGGCAAACTGGGAC
AAGTACGCCCAGGATGACGACGGCAGGGCCGGCAGCGAAAGTGGTTCGAGCGTCGAGTACGAGGGTCCCGGCGCA
GCTGCTTGA
Transcript >Hirsu2|5043
ATGTACGGGACGGGAACCGGCCCCCAGACGGGCATTTCCACCCCCAGATCTAATTCCTCGCTCCGGCCATTGACT
TTGGCCCATGGCTCCCTCGAAACATCGTTCCTCATCCCGACCAATCTCCATTTCCATGCCTCGCAGCTGAAAGAC
CGCTTCGTGGCTTCTCTGCCCACGGCCACCGACGAGCTTGCCCAGGATGACGAGCCTTCATCCGTACCCGAGCTG
GTTGCCAGATACCTGGGATTCGTGGCCCGCGAGGTGGAAGAGGGTGAGGATGACGCGCAAGGCTCATACGAGGAA
GTGCTCAAGCTCGTCCTCAACGAGTTTGAGAGAGCTTTCCTGCGCGGCAACGAGGTCCACGCCGTGGCCGCCACC
CTCCCGGGCATCGAGTCCAAGAAGCTCGAGGTGATTCGCAGCTACTACCTCGCCCGCGCTGTTTCCAACAGGACC
ATCAAACCACACGAGTCGGCCCTGCTGCGCGCTTCCGACGATGGCTCCGCTGAGATCTTTACCATCTTCGGCGGT
CAGGGCAACATTGAGGAGTACTTCGAGGAGCTTCGCGAGGTTTTCCGGACATACCCGAGCTTTGTCGGCGAGCTC
ATCACCTCCGCTGCCGAACAACTCCAGACGCTGTCCAACCACCCCAGCGCCGAAAAGATGTTCCCCAAGGGGCTC
GACATCATGAACTGGCTGCAGCACCCGGACTCTACCCCGGATGTCGACTACCTGATCTCGGCACCCGTCAGCTTT
CCCCTGATTGGGCTGGTTCAGATGACGCATTACGAGGTCACTTGCAAGGTGCTCGGCATCGACCCCGGCCAGCTG
CGGGAGCGCATCAGCGGCACTACCGGTCACTCCCAGGGCATCGTCATGGCCGCCGCCACTGCTGCCGCCGACTCC
TGGGACTCGTGGCGGGACATTGTGAGCTCGACTCTGGCGATCCTGTTCTGGATCGGAACACGAAGCCAGCAGGCG
TTCCCCACCACGTCCATGACGCCCACCATGCTGCGCGAGTCCATGGACCACGGCGAGGGCACGCCAACGCCTATG
CTCAGCATCCGAGATTTATCACAGCAGGAGGTCCAGAAGCATATCGATGCTACCAATCAATACCTTCCGCCGGAC
CGCCACATCAGTGTATCGCTCATCAATAGCCCGCGCAACCTTGTTGTCACGGGGCCACCTACCTCTCTCTACGGC
CTCAACTCGCAGCTGCGTAAAGTCAAGGCTCCCACGGGTCTTGATCAAAATCGTGTGCCATACACCGAGCGCAAG
ATCCGCTTCGTGAACCGATTCCTCCCCATCACTGCTCCATTTCACAGCAAATACCTCTCAGAGGCGACTGCTATG
ATCGACGAGGACCTCAAGGACGTCAGCATCGAGTCCGGCTCCCTGGGGATCCCCGTCTTCGACACAAATACGGGC
AAGAACCTCCGCTCTGAGACCGGTGGTAACATTGTCCCTGCCCTGGTCCGCCTGATCACCCGTGATCCTGTCAAC
TGGGAGAAGGCAACTGTCTTCGGCAAAGCAACACACATCCTCGACTTTGGCCCCGGCGGCGTGTCCGGTCTCGGT
GTCCTGACGAGCCGAAACAAGGAAGGAACCGGAGTCCGTGTGATTCTCGCCGGCACTGTGGATGGCACCATCACG
GAGGTCGGCTACAAGCCGGAGCTCTTCGATAGGGACGAAGATAATGCCATCAGGTATGCCATAGACTGGGTCAAG
GAGTTTGCTCCCAGATTAGTGAAGACGTCAAGCGGGCAGAAATATGTCGACACAAGGATGAGCCGTCTCCTCGGC
CTGCCCCCTGTCATGGTCGCCGCCATGGCTCCCGCCACGGCTCCCTGGGACTTTGTCGCCGCCACCATGAATGCG
GGATATCACATCGAACTCGCCGGTGGTGCCTACTTCAATGCGAAGAAGATGACGGACGCCCTTTCTAAAATCGAA
AAGGCAATTCCTGCGGGTCGCGGCATCTCCGTCAATCTTATTTACGTGAACCCGCGAGCTATGGCGTGGCAGATC
CCCTTGATCGGCAGGCTGCGATCAGAGGGCGTCCCAATCCAGGGCCTGACCATTGGAGCCGGCGTGCCTTCCATC
GAAGTCGCGCAGGAGTACATTGACACCTTGGGTCTGAAGCACATAGCTTTCAAGCCCGGCTCCGTCGAAGCTATT
CAGGCCGTTATCAACATCGCCAAGGCAAACCCGAGCTTCCCCGTCATTCTTCAGTGGACTGGTGGCCGAGGCGGT
GGTCATCACTCCTATGAGGATTTCCACCAGCCGATGCTGCAGATGTACGGCCGGGTTCGGCGGCAAGACAACATC
GTCCTGGTCGCTGGCAGCGGCTTCGGTGGCGCAGATGACACCTACCCGTACATCACTGGCGACTGGGCCAAGAAG
TACGGCTATCCTCCGATGCCCTTCGACGGCTGCTTGTTCGGGAGTCGCATGATGGTCGCCAGGGAAGCGCACACG
AGCAAGAGCGCGAAGCAGGCCATCGTCGACGCTCCTGGCGTTGGTGATGGTGAGTGGGAGAAGACGTACAAAGGC
CCTGCCGGCGGCGTCATCACGGTGCGATCGGAGATGGGTGAGCCTATCCACAAGCTCGCAACCCGAGGCGTTCGA
TTCTGGGCGGAGATGGACCAGAAGATCTTCAGTTTGCCCAAAGAGAAGAGAGTGGCAGAGCTGAAAAAGAGCCGG
GAGTATATCATCAAGAAGCTCAATGATGACTTCCAGAAGGTTTGGTTCGGCTGCAATAAGTCAGGAAAAGCCGTC
GATTTGGAGGATATGACGTACGCTGAGGTCGTGCGGCGGCTGGTCGAGCTGCTCTATGTCAAGCACCAGTCTCGA
TGGATCGATCCATCGTTCGCGAGACTCACTGGCGATTTCATTCATCGGGTCGAGGAACGTTTCACCACCGCGCCT
GGTCAGCCGTCCAGGCTCCAGAATTACTCGGACTTGGATGAGCCTTTCAGTGCCGTTGACCGGATCCTAGCCCAC
TATCCCGAGGCCGAGACTCAAATCATCAACGCGCAGGACGTTCAGCACGTTTTGCTGCTCTGCATGCGGCGAGGC
CAGAAACCCGTGACGTTCATCCCGGCCCTGGACGAGAATTTTGAGTTTTTCTTCAAGAAGGACTCACTTTGGCAG
TCCGAGGACCTGGATGCCGTCATCGGCCAGGATGTCGGACGGACCTGCATTCTCCAGGGTCCCACGGCTGCCAAG
TTCTCGACCGTCCTTGACGAACCAATCAAGGACATTCTTGATGGCATTCACCACGCTCATATCACTGCACTGACG
CGGGACTACTATAACAACGACGAGCGTTCCATCCCAGCAGTCGAGTACTTCGGTGGGAAGCTGGTGGAGCCAGAG
GTGCCGCTCGACGTCGAAGGACTGACCGTGCACTACGATACTCACAAAAACACCTACCGTCTGTCATCCTCTCCG
ACTGCCGTTCTGCCATCTCTCGATTCGTGGCTGTCTCTTCTGGCGGGTCCCAATCGCAACTGGAGATACGCACTC
CTGATGTCGGATATTGTTGTTCAAGGCCAGAAATTCCAGACAAACCCGATCCGACGCATCTTTGCACCCGTCCGA
GGCTTGTTTGTGGAGATTGAGTTCCCCAACGAGCCGGACAAGACGTCGATTGTGGTCCGCGAGCAGCCGAGACAC
AACCAGTATGTGGATGTCATCGAGGTCAAGTTGACCGGCAAGAACGAGATTCTCGTCAACCTGATTAAAGATACA
ACGGCCCTCGGCAAGCCTGTTGCCATGCCCCTGAAGTTCACCTACCGTCCCGAAGCTGGCTACGCCCCCATCCAT
GAGGTCATGCAGGATCGCAACGATCGCATCAAGGAGTTCTACTGGAAGGCATGGTTCGGCAACGACCCTTTGAAT
CTGGATGCCGTCGTCACGAGCAAGTTCGACGGAGGCCGCACCACCATCACCAGCGAGGCCATCCGAGACTTTGTG
CACGCTGTCGGCAACACGGGCGAGGCCTTTGTCGACCGGCCAGGAAAGACAGTCTACGCACCTATGGACTTTGCC
ATTGTCGTGGGCTGGAAAGCCATCACGAAGCCCATCTTCCCCCGGACCATAGATGGCGACCTTCTCAAGCTCGTC
CACCTGTCGAACCAGTTCCGAATGATTCATGGGGCAGAGCCGCTAAAGAAGGGCGATGAGATCTCCACCACTGCG
CAAATCAACGCTGTCATTAACCAGGACTCGGGTAAGATGGTCGAGGTGTGTGGCACCATCGTAAGAGATGGGAAG
CCCGTGATGGAGGTCACTTCGCAGTTTCTGTATCGCGGGGCTTACTTGGATTACGAGAACACATTCCAGCGCAAG
GTCGAGACTCCCGTCCAGGTCCAATTGGCCACAAGCAAGGACGTGGCTGTGCTCCGGTCCAAGAATTGGTTCGCC
ATTGACGAGGTTCCGAGCGACATCGACTTGCTTGGCCAGACCCTTACCTTTCGGCTGCAGAGCCTTGTGCGATAC
AAGAACAAGAATGTCTTCAGCAGTATCGAGACCCGCGGACAGGTGCTGTTGGAGCTGCCCACGAAGGAGGTAATT
CAGGTTGCGAGTGTCGATTACGAAGCCGGCGAGTCCCACGGCAACCCGGTCATTGACTACTTGGAGCGAAACGGC
TCGCCGCTCGACCAGCCCATCTACTTCGAAAACCCGATCCCCCTGAGCGGTAAAACTCCCCTGCAGCTCCGCGCT
CCAGCCTCAAACGAAACGTATGCTCGCGTCTCTGGAGACTACAACCCCATCCACGTCTCGCGCGTCTTCTCCAGC
TACGCCAACCTCCCCGGAACCATAACCCACGGCATGTACTCCAGCGCTGCTGTCCGAAGCCTCCTCGAGACATGG
GCTGCCGAGAACGACATCGGCCGGGTTCGCAGTTTCCACGCCTCCCTGGTCGGTATGGTACTCCCGAATGACGAC
ATACAGGTAAAGCTGCAACATGTCGGGATGGTTGCCGGGCGCAAAATCATCAAAGTCGAAGTTAACAACACGGAG
ACGGAAGAGAAAGTGCTCCTTGGCGAGGCCGAGATCGAGCAACCGGTGACGGCCTACGTGTTCACCGGCCAGGGA
TCGCAAGAGCAGGGCATGGGTATGGAGCTATACGCGAGCAGCGCCGTCGCCAAGGAAGTCTGGGATCGTGCGGAT
CATTATCTTCTTGACAACTACGGCTTCTCCATCACGAACATTGTCAAGAACAACCCCAAGGAGCTTACCATTCAC
TTTGGTGGACCGAGAGGCAAAGCCATCAGGCATAACTACATGTCCATGACATTCGAGACAGTTGCCACCGACGGG
TCCATCAAGTCGGAGCGCATCTTCAAAGAGATCAACGAAGGCACCACCTGTTACACGTACCGTTCGCCAACCGGC
CTGCTCTCGGCCACGCAGTTTACGCAGCCTGCGCTGACGCTCATGGAGAAGGCCAGCTTCGAAGACATGAAAGCC
CGGGGTCTCGTGCCCAGGGACAGCACGTTTGCCGGCCACTCACTGGGCGAGTACTCGGCGCTGGCCGCGCTGGCC
GACGTGATGCCGATCGAGTCTCTCGTCTCCGTCGTCTTCTACCGGGGTCTGACCATGCAGGTGGCTGTCGAGCGG
GATGCCAGCGGGCGCTCCAACTATTCGATGTGCGCTGTGAACCCGAGCCGCATATCGAAGACGTTCAACGAAGAG
GCATTGCAGTTTGTCGTGAACAACATTGCGGAGGAGACGGGCTGGCTTTTGGAGATTGTCAACTACAACATTGCC
AACATGCAGTACGTGTGTGCGGGCGACTTGAGGGCGCTCGACACACTTGCTGGGGTGACGAACTTCGTCAAGAAG
CAGCAAATCGATATTGAGGAGATGAGAAGCAACATCGAGGAGGCCAAGGGGGCGCTGCGCGAGATCATCCGCGGA
TGCGCGGAAGCAACGCTGAAGAAGCCGCAGCCGCTGGAACTGGAGCGGGGTTTCGCGACAATCCCCCTGCGAGGC
ATCGACGTACCCTTCCACTCGACCTTTTTGAGGTCGGGTGTCAAGCCTTTCCGATCATTCCTGCTCAAGAAGATC
AACAAGACGACGATTGACCCGTCGAAGTTGGTCGGGAAGTACATTCCGAACGTGACGGCCAAGCCGTTTGCGCTC
ACCAAGGACTACTTCGAGGAGGTGTACAAGTTGACTAACTCGCCCAAGATCGGTGCCGTCTTGGCAAACTGGGAC
AAGTACGCCCAGGATGACGACGGCAGGGCCGGCAGCGAAAGTGGTTCGAGCGTCGAGTACGAGGGTCCCGGCGCA
GCTGCTTGA
Gene >Hirsu2|5043
ATGTACGGGACGGGAACCGGCCCCCAGACGGGCATTTCCACCCCCAGATCTAATTCCTCGCTCCGGCCATTGACT
TTGGCCCATGGCTCCCTCGAAACATCGTTCCTCATCCCGACCAATCTCCATTTCCATGCCTCGCAGCTGAAAGAC
CGCTTCGTGGCTTCTCTGCCCACGGCCACCGACGAGCTTGCCCAGGATGACGAGCCTTCATCCGTACCCGAGCTG
GTTGCCAGATACCTGGGATTCGTGGCCCGCGAGGTGGAAGAGGGTGAGGATGACGCGCAAGGCTCATACGAGGAA
GTGCTCAAGCTCGTCCTCAACGAGTTTGAGAGAGCTTTCCTGCGCGGCAACGAGGTCCACGCCGTGGCCGCCACC
CTCCCGGGCATCGAGTCCAAGAAGCTCGAGGTGATTCGCAGCTACTACCTCGCCCGCGCTGTTTCCAACAGGACC
ATCAAACCACACGAGTCGGCCCTGCTGCGCGCTTCCGACGATGGCTCCGCTGAGATCTTTACCATCTTCGGCGGT
CAGGGCAACATTGAGGAGTACTTCGAGGAGCTTCGCGAGGTTTTCCGGACATACCCGAGCTTTGTCGGCGAGCTC
ATCACCTCCGCTGCCGAACAACTCCAGACGCTGTCCAACCACCCCAGCGCCGAAAAGATGTTCCCCAAGGGGCTC
GACATCATGAACTGGCTGCAGCACCCGGACTCTACCCCGGATGTCGACTACCTGATCTCGGCACCCGTCAGCTTT
CCCCTGATTGGGCTGGTTCAGATGACGCATTACGAGGTCACTTGCAAGGTGCTCGGCATCGACCCCGGCCAGCTG
CGGGAGCGCATCAGCGGCACTACCGGTCACTCCCAGGGCATCGTCATGGCCGCCGCCACTGCTGCCGCCGACTCC
TGGGACTCGTGGCGGGACATTGTGAGCTCGACTCTGGCGATCCTGTTCTGGATCGGAACACGAAGCCAGCAGGCG
TTCCCCACCACGTCCATGACGCCCACCATGCTGCGCGAGTCCATGGACCACGGCGAGGGCACGCCAACGCCTATG
CTCAGCATCCGAGATTTATCACAGCAGGAGGTCCAGAAGCATATCGATGCTACCAATCAATACCTTCCGCCGGAC
CGCCACATCAGTGTATCGCTCATCAATAGCCCGCGCAACCTTGTTGTCACGGGGCCACCTACCTCTCTCTACGGC
CTCAACTCGCAGCTGCGTAAAGTCAAGGCTCCCACGGGTCTTGATCAAAATCGTGTGCCATACACCGAGCGCAAG
ATCCGCTTCGTGAACCGATTCCTCCCCATCACTGCTCCATTTCACAGCAAATACCTCTCAGAGGCGACTGCTATG
ATCGACGAGGACCTCAAGGACGTCAGCATCGAGTCCGGCTCCCTGGGGATCCCCGTCTTCGACACAAATACGGGC
AAGAACCTCCGCTCTGAGACCGGTGGTAACATTGTCCCTGCCCTGGTCCGCCTGATCACCCGTGATCCTGTCAAC
TGGGAGAAGGCAACTGTCTTCGGCAAAGCAACACACATCCTCGACTTTGGCCCCGGCGGCGTGTCCGGTCTCGGT
GTCCTGACGAGCCGAAACAAGGAAGGAACCGGAGTCCGTGTGATTCTCGCCGGCACTGTGGATGGCACCATCACG
GAGGTCGGCTACAAGCCGGAGCTCTTCGATAGGGACGAAGATAATGCCATCAGGTATGCCATAGACTGGGTCAAG
GAGTTTGCTCCCAGATTAGTGAAGACGTCAAGCGGGCAGAAATATGTCGACACAAGGATGAGCCGTCTCCTCGGC
CTGCCCCCTGTCATGGTCGCCGCCATGGCTCCCGCCACGGCTCCCTGGGACTTTGTCGCCGCCACCATGAATGCG
GGATATCACATCGAACTCGCCGGTGGTGCCTACTTCAATGCGAAGAAGATGACGGACGCCCTTTCTAAAATCGAA
AAGGCAATTCCTGCGGGTCGCGGCATCTCCGTCAATCTTATTTACGTGAACCCGCGAGCTATGGCGTGGCAGATC
CCCTTGATCGGCAGGCTGCGATCAGAGGGCGTCCCAATCCAGGGCCTGACCATTGGAGCCGGCGTGCCTTCCATC
GAAGTCGCGCAGGAGTACATTGACACCTTGGGTCTGAAGCACATAGCTTTCAAGCCCGGCTCCGTCGAAGCTATT
CAGGCCGTTATCAACATCGCCAAGGCAAACCCGAGCTTCCCCGTCATTCTTCAGTGGACTGGTGGCCGAGGCGGT
GGTCATCACTCCTATGAGGATTTCCACCAGCCGATGCTGCAGATGTACGGCCGGGTTCGGCGGCAAGACAACATC
GTCCTGGTCGCTGGCAGCGGCTTCGGTGGCGCAGATGACACCTACCCGTACATCACTGGCGACTGGGCCAAGAAG
TACGGCTATCCTCCGATGCCCTTCGACGGCTGCTTGTTCGGGAGTCGCATGATGGTCGCCAGGGAAGCGCACACG
AGCAAGAGCGCGAAGCAGGCCATCGTCGACGCTCCTGGCGTTGGTGATGGTGAGTGGGAGAAGACGTACAAAGGC
CCTGCCGGCGGCGTCATCACGGTGCGATCGGAGATGGGTGAGCCTATCCACAAGCTCGCAACCCGAGGCGTTCGA
TTCTGGGCGGAGATGGACCAGAAGATCTTCAGTTTGCCCAAAGAGAAGAGAGTGGCAGAGCTGAAAAAGAGCCGG
GAGTATATCATCAAGAAGCTCAATGATGACTTCCAGAAGGTTTGGTTCGGCTGCAATAAGTCAGGAAAAGCCGTC
GATTTGGAGGATATGACGTACGCTGAGGTCGTGCGGCGGCTGGTCGAGCTGCTCTATGTCAAGCACCAGTCTCGA
TGGATCGATCCATCGTTCGCGAGACTCACTGGCGATTTCATTCATCGGGTCGAGGAACGTTTCACCACCGCGCCT
GGTCAGCCGTCCAGGCTCCAGAATTACTCGGACTTGGATGAGCCTTTCAGTGCCGTTGACCGGATCCTAGCCCAC
TATCCCGAGGCCGAGACTCAAATCATCAACGCGCAGGACGTTCAGCACGTTTTGCTGCTCTGCATGCGGCGAGGC
CAGAAACCCGTGACGTTCATCCCGGCCCTGGACGAGAATTTTGAGTTTTTCTTCAAGAAGGACTCACTTTGGCAG
TCCGAGGACCTGGATGCCGTCATCGGCCAGGATGTCGGACGGACCTGCATTCTCCAGGGTCCCACGGCTGCCAAG
TTCTCGACCGTCCTTGACGAACCAATCAAGGACATTCTTGATGGCATTCACCACGCTCATATCACTGCACTGACG
CGGGACTACTATAACAACGACGAGCGTTCCATCCCAGCAGTCGAGTACTTCGGTGGGAAGCTGGTGGAGCCAGAG
GTGCCGCTCGACGTCGAAGGACTGACCGTGCACTACGATACTCACAAAAACACCTACCGTCTGTCATCCTCTCCG
ACTGCCGTTCTGCCATCTCTCGATTCGTGGCTGTCTCTTCTGGCGGGTCCCAATCGCAACTGGAGATACGCACTC
CTGATGTCGGATATTGTTGTTCAAGGCCAGAAATTCCAGACAAACCCGATCCGACGCATCTTTGCACCCGTCCGA
GGCTTGTTTGTGGAGATTGAGTTCCCCAACGAGCCGGACAAGACGTCGATTGTGGTCCGCGAGCAGCCGAGACAC
AACCAGTATGTGGATGTCATCGAGGTCAAGTTGACCGGCAAGAACGAGATTCTCGTCAACCTGATTAAAGATACA
ACGGCCCTCGGCAAGCCTGTTGCCATGCCCCTGAAGTTCACCTACCGTCCCGAAGCTGGCTACGCCCCCATCCAT
GAGGTCATGCAGGATCGCAACGATCGCATCAAGGAGTTCTACTGGAAGGCATGGTTCGGCAACGACCCTTTGAAT
CTGGATGCCGTCGTCACGAGCAAGTTCGACGGAGGCCGCACCACCATCACCAGCGAGGCCATCCGAGACTTTGTG
CACGCTGTCGGCAACACGGGCGAGGCCTTTGTCGACCGGCCAGGAAAGACAGTCTACGCACCTATGGACTTTGCC
ATTGTCGTGGGCTGGAAAGCCATCACGAAGCCCATCTTCCCCCGGACCATAGATGGCGACCTTCTCAAGCTCGTC
CACCTGTCGAACCAGTTCCGAATGATTCATGGGGCAGAGCCGCTAAAGAAGGGCGATGAGATCTCCACCACTGCG
CAAATCAACGCTGTCATTAACCAGGACTCGGGTAAGATGGTCGAGGTGTGTGGCACCATCGTAAGAGATGGGAAG
CCCGTGATGGAGGTCACTTCGCAGTTTCTGTATCGCGGGGCTTACTTGGATTACGAGAACACATTCCAGCGCAAG
GTCGAGACTCCCGTCCAGGTCCAATTGGCCACAAGCAAGGACGTGGCTGTGCTCCGGTCCAAGAATTGGTTCGCC
ATTGACGAGGTTCCGAGCGACATCGACTTGCTTGGCCAGACCCTTACCTTTCGGCTGCAGAGCCTTGTGCGATAC
AAGAACAAGAATGTCTTCAGCAGTATCGAGACCCGCGGACAGGTGCTGTTGGAGCTGCCCACGAAGGAGGTAATT
CAGGTTGCGAGTGTCGATTACGAAGCCGGCGAGTCCCACGGCAACCCGGTCATTGACTACTTGGAGCGAAACGGC
TCGCCGCTCGACCAGCCCATCTACTTCGAAAACCCGATCCCCCTGAGCGGTAAAACTCCCCTGCAGCTCCGCGCT
CCAGCCTCAAACGAAACGTATGCTCGCGTCTCTGGAGACTACAACCCCATCCACGTCTCGCGCGTCTTCTCCAGC
TACGCCAACCTCCCCGGAACCATAACCCACGGCATGTACTCCAGCGCTGCTGTCCGAAGCCTCCTCGAGACATGG
GCTGCCGAGAACGACATCGGCCGGGTTCGCAGTTTCCACGCCTCCCTGGTCGGTATGGTACTCCCGAATGACGAC
ATACAGGTAAAGCTGCAACATGTCGGGATGGTTGCCGGGCGCAAAATCATCAAAGTCGAAGTTAACAACACGGAG
ACGGAAGAGAAAGTGCTCCTTGGCGAGGCCGAGATCGAGCAACCGGTGACGGCCTACGTGTTCACCGGCCAGGGA
TCGCAAGAGCAGGGCATGGGTATGGAGCTATACGCGAGCAGCGCCGTCGCCAAGGAAGTCTGGGATCGTGCGGAT
CATTATCTTCTTGACAACTACGGTAAGCCGTGTGGCGGCCAGAATCCGCCATGCATCATCCGTGTCAAAACAGGA
ATCAAAATCAAGAAATGGCTGACGTCTTTTTTTCCGTCCAGGCTTCTCCATCACGAACATTGTCAAGAACAACCC
CAAGGAGCTTACCATTCACTTTGGTGGACCGAGAGGCAAAGCCATCAGGCATAACTACATGTCCATGACATTCGA
GACAGTTGCCACCGACGGGTCCATCAAGTCGGAGCGCATCTTCAAAGAGATCAACGAAGGCACCACCTGTTACAC
GTACCGTTCGCCAACCGGCCTGCTCTCGGCCACGCAGTTTACGCAGCCTGCGCTGACGCTCATGGAGAAGGCCAG
CTTCGAAGACATGAAAGCCCGGGGTCTCGTGCCCAGGGACAGCACGTTTGCCGGCCACTCACTGGGCGAGTACTC
GGCGCTGGCCGCGCTGGCCGACGTGATGCCGATCGAGTCTCTCGTCTCCGTCGTCTTCTACCGGGGTCTGACCAT
GCAGGTGGCTGTCGAGCGGGATGCCAGCGGGCGCTCCAACTATTCGATGTGCGCTGTGAACCCGAGCCGCATATC
GAAGACGTTCAACGAAGAGGCATTGCAGTTTGTCGTGAACAACATTGCGGAGGAGACGGGCTGGCTTTTGGAGAT
TGTCAACTACAACATTGCCAACATGCAGTACGTGTGTGCGGGCGACTTGAGGGCGCTCGACACACTTGCTGGGGT
GACGAACTTCGTCAAGAAGCAGCAAATCGATATTGAGGAGATGAGAAGCAACATCGAGGAGGCCAAGGGGGCGCT
GCGCGAGATCATCCGCGGATGCGCGGAAGCAACGCTGAAGAAGCCGCAGCCGCTGGAACTGGAGCGGGGTTTCGC
GACAATCCCCCTGCGAGGCATCGACGTACCCTTCCACTCGACCTTTTTGAGGTCGGGTGTCAAGCCTTTCCGATC
ATTCCTGCTCAAGAAGATCAACAAGACGACGATTGACCCGTCGAAGTTGGTCGGGAAGTACATTCCGAACGTGAC
GGCCAAGCCGTTTGCGCTCACCAAGGACTACTTCGAGGAGGTGTACAAGTTGACTAACTCGCCCAAGATCGGTGC
CGTCTTGGCAAACTGGGACAAGTACGCCCAGGATGACGACGGCAGGGCCGGCAGCGAAAGTGGTTCGAGCGTCGA
GTACGAGGGTCCCGGCGCAGCTGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail