Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5025
Gene name
LocationContig_252:11999..13721
Strand-
Gene length (bp)1722
Transcript length (bp)1605
Coding sequence length (bp)1605
Protein length (aa) 535

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 5.8E-19 228 454
PF10340 Say1_Mug180 Steryl acetyl hydrolase 3.6E-14 208 433

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6PIU2|NCEH1_HUMAN Neutral cholesterol ester hydrolase 1 OS=Homo sapiens GN=NCEH1 PE=1 SV=3 218 323 3.0E-09
sp|Q8BLF1|NCEH1_MOUSE Neutral cholesterol ester hydrolase 1 OS=Mus musculus GN=Nceh1 PE=1 SV=1 218 323 5.0E-09
sp|Q9HDV1|MU180_SCHPO Putative steryl acetyl hydrolase mug81 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug180 PE=1 SV=1 101 427 6.0E-09
sp|Q1JQE6|NCEH1_BOVIN Neutral cholesterol ester hydrolase 1 OS=Bos taurus GN=NCEH1 PE=2 SV=2 218 323 6.0E-09
sp|Q5R8Y5|NCEH1_PONAB Neutral cholesterol ester hydrolase 1 OS=Pongo abelii GN=NCEH1 PE=2 SV=1 218 312 9.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6PIU2|NCEH1_HUMAN Neutral cholesterol ester hydrolase 1 OS=Homo sapiens GN=NCEH1 PE=1 SV=3 218 323 3.0E-09
sp|Q8BLF1|NCEH1_MOUSE Neutral cholesterol ester hydrolase 1 OS=Mus musculus GN=Nceh1 PE=1 SV=1 218 323 5.0E-09
sp|Q9HDV1|MU180_SCHPO Putative steryl acetyl hydrolase mug81 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug180 PE=1 SV=1 101 427 6.0E-09
sp|Q1JQE6|NCEH1_BOVIN Neutral cholesterol ester hydrolase 1 OS=Bos taurus GN=NCEH1 PE=2 SV=2 218 323 6.0E-09
sp|Q5R8Y5|NCEH1_PONAB Neutral cholesterol ester hydrolase 1 OS=Pongo abelii GN=NCEH1 PE=2 SV=1 218 312 9.0E-09
sp|P54310|LIPS_MOUSE Hormone-sensitive lipase OS=Mus musculus GN=Lipe PE=1 SV=2 211 366 9.0E-09
sp|B2GV54|NCEH1_RAT Neutral cholesterol ester hydrolase 1 OS=Rattus norvegicus GN=Nceh1 PE=2 SV=1 218 323 9.0E-09
sp|P16386|LIPS_BOVIN Hormone-sensitive lipase OS=Bos taurus GN=LIPE PE=1 SV=2 196 325 1.0E-08
sp|Q68J42|LIPS_PIG Hormone-sensitive lipase OS=Sus scrofa GN=LIPE PE=2 SV=1 189 366 2.0E-08
sp|P15304|LIPS_RAT Hormone-sensitive lipase OS=Rattus norvegicus GN=Lipe PE=1 SV=3 211 366 2.0E-08
sp|Q05469|LIPS_HUMAN Hormone-sensitive lipase OS=Homo sapiens GN=LIPE PE=1 SV=4 218 366 4.0E-07
sp|O06350|LIPF_MYCTU Carboxylesterase LipF OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lipF PE=1 SV=3 226 320 7.0E-07
sp|Q9R101|LIPS_ICTTR Hormone-sensitive lipase OS=Ictidomys tridecemlineatus GN=LIPE PE=2 SV=1 196 325 8.0E-07
sp|Q0TKG5|AES_ECOL5 Acetyl esterase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aes PE=3 SV=1 218 328 8.0E-07
sp|Q3Z4S3|AES_SHISS Acetyl esterase OS=Shigella sonnei (strain Ss046) GN=aes PE=3 SV=1 218 328 1.0E-06
sp|B7M3W8|AES_ECO8A Acetyl esterase OS=Escherichia coli O8 (strain IAI1) GN=aes PE=3 SV=1 218 328 1.0E-06
sp|B7N929|AES_ECOLU Acetyl esterase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aes PE=3 SV=1 218 328 1.0E-06
sp|Q8FK82|AES_ECOL6 Acetyl esterase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aes PE=3 SV=1 218 328 1.0E-06
sp|B7MQJ1|AES_ECO81 Acetyl esterase OS=Escherichia coli O81 (strain ED1a) GN=aes PE=3 SV=1 218 328 1.0E-06
sp|B1LJN4|AES_ECOSM Acetyl esterase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aes PE=3 SV=1 218 328 2.0E-06
sp|P23872|AES_ECOLI Acetyl esterase OS=Escherichia coli (strain K12) GN=aes PE=1 SV=3 218 328 2.0E-06
sp|B1XFR3|AES_ECODH Acetyl esterase OS=Escherichia coli (strain K12 / DH10B) GN=aes PE=3 SV=1 218 328 2.0E-06
sp|C4ZUT0|AES_ECOBW Acetyl esterase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aes PE=3 SV=1 218 328 2.0E-06
sp|B7NIF4|AES_ECO7I Acetyl esterase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aes PE=3 SV=1 218 328 2.0E-06
sp|P9WK85|LIPR_MYCTU Putative acetyl-hydrolase LipR OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lipR PE=1 SV=1 196 360 2.0E-06
sp|P9WK84|LIPR_MYCTO Putative acetyl-hydrolase LipR OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=lipR PE=3 SV=1 196 360 2.0E-06
sp|Q1RF59|AES_ECOUT Acetyl esterase OS=Escherichia coli (strain UTI89 / UPEC) GN=aes PE=3 SV=1 218 328 2.0E-06
sp|A1A8E2|AES_ECOK1 Acetyl esterase OS=Escherichia coli O1:K1 / APEC GN=aes PE=3 SV=1 218 328 2.0E-06
sp|A7ZXD4|AES_ECOHS Acetyl esterase OS=Escherichia coli O9:H4 (strain HS) GN=aes PE=3 SV=1 218 328 2.0E-06
sp|B7MDZ8|AES_ECO45 Acetyl esterase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aes PE=3 SV=1 218 328 2.0E-06
sp|B7UKF6|AES_ECO27 Acetyl esterase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aes PE=3 SV=1 218 328 2.0E-06
sp|B5Z3Y7|AES_ECO5E Acetyl esterase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aes PE=3 SV=1 218 328 2.0E-06
sp|Q8XD38|AES_ECO57 Acetyl esterase OS=Escherichia coli O157:H7 GN=aes PE=3 SV=1 218 328 2.0E-06
sp|Q83M39|AES_SHIFL Acetyl esterase OS=Shigella flexneri GN=aes PE=3 SV=2 218 328 3.0E-06
sp|Q0T7A9|AES_SHIF8 Acetyl esterase OS=Shigella flexneri serotype 5b (strain 8401) GN=aes PE=3 SV=1 218 328 3.0E-06
sp|B1IZB8|AES_ECOLC Acetyl esterase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aes PE=3 SV=1 218 328 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 63 85 22
3 89 111 22
4 145 167 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5025
MPLSVNLDQASPSSAEPLPVSTPLSLVFSLVFSLLSLFSLFSHVWPRRSNVGKGAEARREATTIILGPVSLVDYL
VGLICLAPSLIRHVGLVPLLCIGFQSLLFLVFRLPFGLVRDHFWLPASSLPQFVREATVFEDIARRYFRYACVNL
PFCVVRLLFSKAFWLPLFRWRMLRHGHWKSSAYWHEQQVRQIAPPRRDQTTKEQRGSMTSPGLWIKHKPEQPPDL
VVYYIHGGGFALCSSYLYLESLLALNHLLVEAGFENPAVFALEYTLVPQANFPMQLAEVLHGYRHVLDVAKSASR
VCVAGDSAGGYLVLNLLLRLGSQAVNPGPEEAGTGPSEAPPAPLPHMAALISPWVDVKIDDHYPSEVDYILEAKI
CEYARECAKGLTAGQLQASPAACTDPELWRAACPRRGYFVIYGEEEAFAPDIEDFIQRRSQSGDEISALRFGGGI
HDWAILSMIVSSTQSRRQQGLRYLAEHVSKQFLATKRGKRQSRYRGPQIRSSSLSVSGRVEKRRFENQSRTRAWL
RRRPAESNG*
Coding >Hirsu2|5025
ATGCCCTTGTCTGTCAATCTTGATCAAGCCTCCCCGTCCTCCGCCGAGCCTCTTCCAGTCTCGACGCCCCTCTCT
CTCGTATTCTCTCTCGTGTTCTCTCTCCTTTCACTCTTCTCGTTGTTCTCCCATGTCTGGCCGCGTCGGTCAAAT
GTCGGAAAGGGCGCCGAAGCCCGCCGTGAAGCGACGACCATTATCCTCGGCCCCGTCTCTCTCGTCGACTATCTA
GTCGGCCTCATTTGCCTGGCACCCAGCCTGATCAGGCACGTCGGTCTCGTCCCTCTGCTCTGTATCGGCTTTCAA
AGTCTCCTCTTCCTAGTGTTCCGGCTCCCCTTTGGCCTCGTGCGAGACCACTTTTGGCTGCCCGCCTCTTCGCTC
CCGCAATTCGTGCGCGAGGCCACCGTCTTTGAAGACATCGCCCGCAGATACTTTCGATACGCCTGTGTCAACCTC
CCGTTTTGCGTTGTGAGGCTACTCTTCTCCAAGGCGTTCTGGCTGCCGCTGTTTCGCTGGCGGATGCTGAGGCAC
GGGCACTGGAAAAGCTCGGCGTACTGGCACGAGCAGCAAGTCCGACAGATAGCTCCACCACGACGTGACCAGACG
ACTAAGGAACAGCGGGGCAGCATGACAAGCCCGGGCCTGTGGATAAAGCACAAGCCAGAGCAGCCCCCCGACTTG
GTCGTGTACTATATTCATGGTGGCGGCTTCGCCCTCTGCTCCAGTTACCTCTACCTCGAATCACTTCTCGCTCTG
AACCACCTGCTCGTCGAGGCCGGGTTCGAGAACCCAGCCGTCTTCGCACTTGAATATACCCTTGTTCCTCAGGCG
AATTTTCCGATGCAGTTGGCCGAGGTCTTGCACGGTTATAGGCACGTTCTCGACGTGGCCAAGAGCGCCTCCCGA
GTCTGCGTCGCCGGAGACTCTGCCGGAGGCTACTTGGTTCTCAATCTCCTACTGCGGCTGGGAAGCCAGGCAGTC
AACCCAGGGCCGGAGGAGGCCGGGACAGGTCCAAGCGAAGCTCCGCCTGCACCGCTACCTCATATGGCTGCACTG
ATATCGCCCTGGGTAGACGTCAAAATCGACGATCACTATCCGTCCGAGGTAGACTACATACTCGAAGCAAAAATC
TGTGAATATGCGCGTGAGTGCGCCAAGGGGCTCACGGCTGGACAGCTGCAGGCCTCGCCGGCGGCGTGCACCGAT
CCAGAGCTGTGGAGGGCGGCGTGCCCACGACGCGGCTACTTCGTCATCTACGGCGAGGAGGAGGCGTTTGCGCCG
GATATCGAGGACTTTATACAGCGTCGGTCACAGAGTGGCGATGAGATTTCAGCGTTGCGATTCGGCGGCGGGATC
CACGATTGGGCAATCCTCTCGATGATCGTATCCAGCACGCAATCCAGGAGGCAGCAGGGGTTGAGATACCTTGCG
GAACACGTTAGCAAGCAATTTCTGGCCACGAAGCGGGGAAAACGGCAATCAAGGTACAGAGGCCCTCAGATTAGA
TCAAGTAGTTTATCAGTCTCTGGCCGAGTAGAGAAGCGGCGGTTCGAGAACCAGAGCCGTACACGGGCCTGGCTC
CGTCGCCGCCCGGCCGAGTCAAATGGATAA
Transcript >Hirsu2|5025
ATGCCCTTGTCTGTCAATCTTGATCAAGCCTCCCCGTCCTCCGCCGAGCCTCTTCCAGTCTCGACGCCCCTCTCT
CTCGTATTCTCTCTCGTGTTCTCTCTCCTTTCACTCTTCTCGTTGTTCTCCCATGTCTGGCCGCGTCGGTCAAAT
GTCGGAAAGGGCGCCGAAGCCCGCCGTGAAGCGACGACCATTATCCTCGGCCCCGTCTCTCTCGTCGACTATCTA
GTCGGCCTCATTTGCCTGGCACCCAGCCTGATCAGGCACGTCGGTCTCGTCCCTCTGCTCTGTATCGGCTTTCAA
AGTCTCCTCTTCCTAGTGTTCCGGCTCCCCTTTGGCCTCGTGCGAGACCACTTTTGGCTGCCCGCCTCTTCGCTC
CCGCAATTCGTGCGCGAGGCCACCGTCTTTGAAGACATCGCCCGCAGATACTTTCGATACGCCTGTGTCAACCTC
CCGTTTTGCGTTGTGAGGCTACTCTTCTCCAAGGCGTTCTGGCTGCCGCTGTTTCGCTGGCGGATGCTGAGGCAC
GGGCACTGGAAAAGCTCGGCGTACTGGCACGAGCAGCAAGTCCGACAGATAGCTCCACCACGACGTGACCAGACG
ACTAAGGAACAGCGGGGCAGCATGACAAGCCCGGGCCTGTGGATAAAGCACAAGCCAGAGCAGCCCCCCGACTTG
GTCGTGTACTATATTCATGGTGGCGGCTTCGCCCTCTGCTCCAGTTACCTCTACCTCGAATCACTTCTCGCTCTG
AACCACCTGCTCGTCGAGGCCGGGTTCGAGAACCCAGCCGTCTTCGCACTTGAATATACCCTTGTTCCTCAGGCG
AATTTTCCGATGCAGTTGGCCGAGGTCTTGCACGGTTATAGGCACGTTCTCGACGTGGCCAAGAGCGCCTCCCGA
GTCTGCGTCGCCGGAGACTCTGCCGGAGGCTACTTGGTTCTCAATCTCCTACTGCGGCTGGGAAGCCAGGCAGTC
AACCCAGGGCCGGAGGAGGCCGGGACAGGTCCAAGCGAAGCTCCGCCTGCACCGCTACCTCATATGGCTGCACTG
ATATCGCCCTGGGTAGACGTCAAAATCGACGATCACTATCCGTCCGAGGTAGACTACATACTCGAAGCAAAAATC
TGTGAATATGCGCGTGAGTGCGCCAAGGGGCTCACGGCTGGACAGCTGCAGGCCTCGCCGGCGGCGTGCACCGAT
CCAGAGCTGTGGAGGGCGGCGTGCCCACGACGCGGCTACTTCGTCATCTACGGCGAGGAGGAGGCGTTTGCGCCG
GATATCGAGGACTTTATACAGCGTCGGTCACAGAGTGGCGATGAGATTTCAGCGTTGCGATTCGGCGGCGGGATC
CACGATTGGGCAATCCTCTCGATGATCGTATCCAGCACGCAATCCAGGAGGCAGCAGGGGTTGAGATACCTTGCG
GAACACGTTAGCAAGCAATTTCTGGCCACGAAGCGGGGAAAACGGCAATCAAGGTACAGAGGCCCTCAGATTAGA
TCAAGTAGTTTATCAGTCTCTGGCCGAGTAGAGAAGCGGCGGTTCGAGAACCAGAGCCGTACACGGGCCTGGCTC
CGTCGCCGCCCGGCCGAGTCAAATGGATAA
Gene >Hirsu2|5025
ATGCCCTTGTCTGTCAATCTTGATCAAGCCTCCCCGTCCTCCGCCGAGCCTCTTCCAGTCTCGACGCCCCTCTCT
CTCGTATTCTCTCTCGTGTTCTCTCTCCTTTCACTCTTCTCGTTGTTCTCCCATGTCTGGCCGCGTCGGTCAAAT
GTCGGAAAGGGCGCCGAAGCCCGCCGTGAAGCGACGACCATTATCCTCGGCCCCGTCTCTCTCGTCGACTATCTA
GTCGGCCTCATTTGCCTGGCACCCAGCCTGATCAGGCACGTCGGTCTCGTCCCTCTGCTCTGTATCGGCTTTCAA
AGTCTCCTCTTCCTAGGTACGGAACCACAGACGTCTTGGCTCGTGTCGCTCGCCAGAGCCCAGCAAGACTCACAC
TGCCACAGTGTTCCGGCTCCCCTTTGGCCTCGTGCGAGACCACTTTTGGCTGCCCGCCTCTTCGCTCCCGCAATT
CGTGCGCGAGGCCACCGTCTTTGAAGACATCGCCCGCAGATACTTTCGATACGCCTGTGTCAACCTCCCGTTTTG
CGTTGTGAGGCTACTCTTCTCCAAGGCGTTCTGGCTGCCGCTGTTTCGCTGGCGGATGCTGAGGCACGGGCACTG
GAAAAGCTCGGCGTACTGGCACGAGCAGCAAGTCCGACAGATAGCTCCACCACGACGTGACCAGACGACTAAGGA
ACAGCGGGGCAGCATGACAAGCCCGGGCCTGTGGATAAAGCACAAGCCAGAGCAGCCCCCCGACTTGGTCGTGTA
CTATATTCATGGTACGGCGACCCCATCTACGTGGCTGTCTGCGCTGTTGACCGGTTATCAGGTGGCGGCTTCGCC
CTCTGCTCCAGTTACCTCTACCTCGAATCACTTCTCGCTCTGAACCACCTGCTCGTCGAGGCCGGGTTCGAGAAC
CCAGCCGTCTTCGCACTTGAATATACCCTTGTTCCTCAGGCGAATTTTCCGATGCAGTTGGCCGAGGTCTTGCAC
GGTTATAGGCACGTTCTCGACGTGGCCAAGAGCGCCTCCCGAGTCTGCGTCGCCGGAGACTCTGCCGGAGGCTAC
TTGGTTCTCAATCTCCTACTGCGGCTGGGAAGCCAGGCAGTCAACCCAGGGCCGGAGGAGGCCGGGACAGGTCCA
AGCGAAGCTCCGCCTGCACCGCTACCTCATATGGCTGCACTGATATCGCCCTGGGTAGACGTCAAAATCGACGAT
CACTATCCGTCCGAGGTAGACTACATACTCGAAGCAAAAATCTGTGAATATGCGCGTGAGTGCGCCAAGGGGCTC
ACGGCTGGACAGCTGCAGGCCTCGCCGGCGGCGTGCACCGATCCAGAGCTGTGGAGGGCGGCGTGCCCACGACGC
GGCTACTTCGTCATCTACGGCGAGGAGGAGGCGTTTGCGCCGGATATCGAGGACTTTATACAGCGTCGGTCACAG
AGTGGCGATGAGATTTCAGCGTTGCGATTCGGCGGCGGGATCCACGATTGGGCAATCCTCTCGATGATCGTATCC
AGCACGCAATCCAGGAGGCAGCAGGGGTTGAGATACCTTGCGGAACACGTTAGCAAGCAATTTCTGGCCACGAAG
CGGGGAAAACGGCAATCAAGGTACAGAGGCCCTCAGATTAGATCAAGTAGTTTATCAGTCTCTGGCCGAGTAGAG
AAGCGGCGGTTCGAGAACCAGAGCCGTACACGGGCCTGGCTCCGTCGCCGCCCGGCCGAGTCAAATGGATAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail