Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5022
Gene name
LocationContig_252:1232..2352
Strand-
Gene length (bp)1120
Transcript length (bp)777
Coding sequence length (bp)777
Protein length (aa) 259

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04889 Cwf_Cwc_15 Cwf15/Cwc15 cell cycle control protein 2.7E-87 1 258

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5B020|CWC15_EMENI Pre-mRNA-splicing factor cwc15 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cwc15 PE=3 SV=1 1 258 3.0E-75
sp|P78794|CWC15_SCHPO Pre-mRNA-splicing factor cwf15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf15 PE=1 SV=2 1 257 5.0E-34
sp|Q9V3B6|CWC15_DROME Protein CWC15 homolog OS=Drosophila melanogaster GN=c12.1 PE=2 SV=1 1 258 4.0E-31
sp|Q5RE65|CWC15_PONAB Spliceosome-associated protein CWC15 homolog OS=Pongo abelii GN=CWC15 PE=2 SV=1 163 258 4.0E-23
sp|Q9P013|CWC15_HUMAN Spliceosome-associated protein CWC15 homolog OS=Homo sapiens GN=CWC15 PE=1 SV=2 163 258 4.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5B020|CWC15_EMENI Pre-mRNA-splicing factor cwc15 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cwc15 PE=3 SV=1 1 258 3.0E-75
sp|P78794|CWC15_SCHPO Pre-mRNA-splicing factor cwf15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf15 PE=1 SV=2 1 257 5.0E-34
sp|Q9V3B6|CWC15_DROME Protein CWC15 homolog OS=Drosophila melanogaster GN=c12.1 PE=2 SV=1 1 258 4.0E-31
sp|Q5RE65|CWC15_PONAB Spliceosome-associated protein CWC15 homolog OS=Pongo abelii GN=CWC15 PE=2 SV=1 163 258 4.0E-23
sp|Q9P013|CWC15_HUMAN Spliceosome-associated protein CWC15 homolog OS=Homo sapiens GN=CWC15 PE=1 SV=2 163 258 4.0E-23
sp|Q5BJP2|CWC15_RAT Spliceosome-associated protein CWC15 homolog OS=Rattus norvegicus GN=Cwc15 PE=1 SV=1 163 258 5.0E-23
sp|Q9JHS9|CWC15_MOUSE Spliceosome-associated protein CWC15 homolog OS=Mus musculus GN=Cwc15 PE=1 SV=1 163 258 5.0E-23
sp|Q2KJD3|CWC15_BOVIN Spliceosome-associated protein CWC15 homolog OS=Bos taurus GN=CWC15 PE=2 SV=1 163 258 6.0E-23
sp|O45766|CWC15_CAEEL Protein CWC15 homolog OS=Caenorhabditis elegans GN=T10C6.5 PE=3 SV=1 163 258 3.0E-22
sp|Q6BP48|CWC15_DEBHA Pre-mRNA-splicing factor CWC15 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CWC15 PE=3 SV=2 1 258 6.0E-17
sp|Q6C0E6|CWC15_YARLI Pre-mRNA-splicing factor CWC15 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CWC15 PE=3 SV=1 1 46 1.0E-09
sp|O45766|CWC15_CAEEL Protein CWC15 homolog OS=Caenorhabditis elegans GN=T10C6.5 PE=3 SV=1 1 46 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0000398 mRNA splicing, via spliceosome Yes
GO:0005681 spliceosomal complex Yes
GO:0006807 nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0000377 RNA splicing, via transesterification reactions with bulged adenosine as nucleophile No
GO:0071704 organic substance metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0032991 protein-containing complex No
GO:1990904 ribonucleoprotein complex No
GO:0006397 mRNA processing No
GO:0016070 RNA metabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0044238 primary metabolic process No
GO:0008380 RNA splicing No
GO:0006725 cellular aromatic compound metabolic process No
GO:0000375 RNA splicing, via transesterification reactions No
GO:0005575 cellular_component No
GO:0044237 cellular metabolic process No
GO:0006396 RNA processing No
GO:0043170 macromolecule metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0016071 mRNA metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.179 0.8092 0.0285 0.0119 0.0809 0.0026 0.0559 0.0205 0.0353 0.0088

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2958
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6260
Ophiocordyceps australis map64 (Brazil) OphauB2|6559
Ophiocordyceps camponoti-floridani Ophcf2|01928
Ophiocordyceps camponoti-rufipedis Ophun1|3016
Ophiocordyceps kimflemingae Ophio5|8438
Ophiocordyceps subramaniannii Hirsu2|5022 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5022
MTTAHRPTFDPARGKEALRGPAYHQRLLPAHTKLKFRKAGQGGDADEEPERDLAAELLAAEAAHHAKKNGGKSVL
ALTHDDDDDDDEVKAAAGSKRRLPDGGGEGGKGQQPQREEDDGDAKRRRILEETRELDADDESDAGSGDDDDDDD
DDDESSDDDDEEAELQRELERVRREREERKKREEAERAEEENEARERDIALGNPLLNKQDFSIKRRWDDDVVFKN
QARGTEDKGKKKEFVNDLLRSDFHRRFMSKYVR*
Coding >Hirsu2|5022
ATGACCACCGCACACAGACCAACGTTCGATCCTGCCAGAGGCAAGGAGGCCCTCCGCGGCCCAGCCTACCACCAA
CGCCTCCTCCCCGCCCACACGAAGCTCAAGTTCCGCAAGGCCGGGCAGGGCGGCGACGCGGACGAGGAGCCGGAG
CGCGACCTCGCGGCCGAGCTGCTCGCGGCCGAGGCGGCGCACCACGCCAAGAAGAACGGCGGCAAGAGCGTGCTC
GCCCTGACTCACGACGACGACGACGACGACGATGAAGTAAAGGCGGCGGCGGGCTCGAAGCGGCGGCTGCCCGAC
GGCGGCGGAGAAGGCGGCAAGGGCCAGCAGCCGCAGCGGGAAGAAGATGACGGCGATGCGAAGCGTCGCCGCATC
CTGGAGGAGACGAGGGAGCTGGACGCGGACGACGAGAGCGACGCGGGCAGCGGGGACGACGACGACGACGACGAC
GATGACGACGAAAGCAGTGATGACGATGACGAGGAGGCGGAGCTGCAGCGCGAGCTGGAGCGGGTGCGGCGCGAG
AGAGAGGAGAGGAAGAAGCGAGAGGAGGCGGAACGAGCGGAAGAGGAAAACGAAGCGCGCGAGCGGGACATTGCG
CTGGGGAACCCGCTGCTCAACAAGCAGGACTTTTCCATCAAGCGGCGCTGGGACGACGACGTCGTCTTCAAGAAC
CAGGCCCGCGGCACCGAGGACAAGGGCAAGAAGAAGGAGTTTGTCAACGATCTTCTGCGGTCCGACTTCCACAGG
CGGTTCATGAGCAAGTACGTCAGGTAG
Transcript >Hirsu2|5022
ATGACCACCGCACACAGACCAACGTTCGATCCTGCCAGAGGCAAGGAGGCCCTCCGCGGCCCAGCCTACCACCAA
CGCCTCCTCCCCGCCCACACGAAGCTCAAGTTCCGCAAGGCCGGGCAGGGCGGCGACGCGGACGAGGAGCCGGAG
CGCGACCTCGCGGCCGAGCTGCTCGCGGCCGAGGCGGCGCACCACGCCAAGAAGAACGGCGGCAAGAGCGTGCTC
GCCCTGACTCACGACGACGACGACGACGACGATGAAGTAAAGGCGGCGGCGGGCTCGAAGCGGCGGCTGCCCGAC
GGCGGCGGAGAAGGCGGCAAGGGCCAGCAGCCGCAGCGGGAAGAAGATGACGGCGATGCGAAGCGTCGCCGCATC
CTGGAGGAGACGAGGGAGCTGGACGCGGACGACGAGAGCGACGCGGGCAGCGGGGACGACGACGACGACGACGAC
GATGACGACGAAAGCAGTGATGACGATGACGAGGAGGCGGAGCTGCAGCGCGAGCTGGAGCGGGTGCGGCGCGAG
AGAGAGGAGAGGAAGAAGCGAGAGGAGGCGGAACGAGCGGAAGAGGAAAACGAAGCGCGCGAGCGGGACATTGCG
CTGGGGAACCCGCTGCTCAACAAGCAGGACTTTTCCATCAAGCGGCGCTGGGACGACGACGTCGTCTTCAAGAAC
CAGGCCCGCGGCACCGAGGACAAGGGCAAGAAGAAGGAGTTTGTCAACGATCTTCTGCGGTCCGACTTCCACAGG
CGGTTCATGAGCAAGTACGTCAGGTAG
Gene >Hirsu2|5022
ATGACCACCGCACACAGACCAACGTTCGATCCTGTTCGTGATGACCCCAGGCCGCCTCCTTTCCCGGCCGTTCCC
CCCCCCCTGCCCGAAGAGTGGGCGAACAGCCGCAGCCGGCGTTGTCGACGTCGGGTCACTAACCGTTTGGCTGTA
GGCCAGAGGCAAGGAGGCCCTCCGCGGCCCAGCCTACCACCAACGCCTCCTCCCCGCCCACACGAAGCTCAAGTT
CCGCAAGGCCGGGCAGGGCGGCGACGCGGACGAGGAGCCGGAGCGCGACCTCGCGGCCGAGCTGCTCGCGGCCGA
GGCGGCGCACCACGCCAAGAAGAACGGCGGCAAGAGCGTGCTCGCCCTGACTCACGACGACGACGACGACGACGA
TGAAGTAAAGGCGGCGGCGGGCTCGAAGCGGCGGCTGCCCGACGGCGGCGGAGAAGGCGGCAAGGGCCAGCAGCC
GCAGCGGGAAGAAGATGACGGCGATGCGAAGCGTCGCCGCATCCTGGAGGAGACGAGGGAGCTGGACGCGGACGA
CGAGAGCGACGCGGGCAGCGGGGACGACGACGACGACGACGACGATGACGACGAAAGCAGTGATGACGATGACGA
GGAGGCGGAGCTGCAGCGCGAGCTGGAGCGGGTGCGGCGCGAGAGAGAGGAGAGGAAGAAGCGAGAGGTACGCTG
CTCACGCGGGAACTTTGTTACCTTTCGCTACCTCTTGGCGCATTTCCCGCGAGGAGGAGAGGCGCCAGGACGTGC
ATCGCTGACTTGGGGGGAAAAAATAGGAGGCGGAACGAGCGGAAGAGGAAAACGAAGCGCGCGAGCGGGACATTG
CGCTGGGGAACCCGCTGCTCAACAAGCAGGACTTTTCCATCAAGCGGCGCTGGGACGACGACGTCGTCTTCAAGA
ACCAGGCCCGCGGCACCGAGGACAAGGGCAAGAAGAAGGAGTTTGTCAACGTATGTTCCTCCATCCCCTGCGGTC
CCTGCCCACGACCTCCCAGCCTCGTCTCCCCCCCTTTCCGTCCTGCTATTTTGTCTTTGGAGATGCTAACGGCCG
TCCCGTCGTGGTGCAGGATCTTCTGCGGTCCGACTTCCACAGGCGGTTCATGAGCAAGTACGTCAGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail