Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5018
Gene name
LocationContig_2513:255..1618
Strand-
Gene length (bp)1363
Transcript length (bp)1296
Coding sequence length (bp)1296
Protein length (aa) 432

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00169 PH PH domain 2.4E-13 52 145
PF00169 PH PH domain 2.6E-07 314 398

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q96WV2|YJO2_SCHPO Uncharacterized PH domain-containing protein PB16A4.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB16A4.02c PE=3 SV=2 48 414 5.0E-16
sp|Q9QXT1|DAPP1_MOUSE Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide OS=Mus musculus GN=Dapp1 PE=1 SV=1 53 144 5.0E-08
sp|Q9UN19|DAPP1_HUMAN Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide OS=Homo sapiens GN=DAPP1 PE=1 SV=1 53 144 9.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5018
MPATQATDVAPRLSSNPQNGCFATGSALRSRSNSHGLEASLNVNGCFESDRVTKCGYVKRRTRKTKKWKTAFIVL
RRNTLSVYKNEKETKLRHQVYLSDLTAVAFLKDPKHKRDNVFGLFSPSKNFHLQASTTKDAQEWVDLIRKDARIE
EEEEEMFLASPTARRLSPTALIALTPPRPGHGFDSHGGERLMVSGSPETHGPPEPVLIAPARRESSNVVDWSDLS
GNELASHSDLSDDEGQNPHGVSRESLGIQSAAEAVSTPRGAGPVARPLARRSASQLSTLDDKSSGNGNNSKTKTI
SVGHLDQDPDRVVWQGWLWMLRSKGGVRQWKHLWAVLRPRILILYKDESEYAAQWLVQLSVVVNVVDIDPLSKSK
KNCLQVITEEKSYRFCAHDEESLVHLIGAFKSLLAKRRGLEAHGGSGSRLEARGTA*
Coding >Hirsu2|5018
ATGCCCGCCACCCAGGCCACCGATGTCGCGCCGCGGCTAAGCTCGAACCCCCAAAACGGATGTTTCGCCACAGGA
TCGGCATTGCGGAGTCGCTCAAACAGCCACGGCCTGGAGGCAAGCCTCAATGTAAACGGCTGTTTTGAGTCTGAT
CGCGTTACCAAGTGCGGCTATGTCAAGAGGCGGACACGGAAGACAAAGAAATGGAAGACTGCTTTTATCGTGTTG
CGGCGAAATACCCTATCCGTATATAAGAACGAGAAAGAGACGAAACTCCGCCACCAGGTCTACCTCTCAGACCTG
ACCGCGGTAGCCTTTCTCAAGGATCCCAAGCACAAGCGTGACAATGTGTTCGGGCTATTCTCTCCATCGAAGAAT
TTCCACCTCCAGGCATCCACAACAAAGGATGCCCAGGAGTGGGTCGACCTCATTCGCAAAGACGCGAGAATTGAA
GAGGAGGAGGAGGAGATGTTCCTTGCCAGCCCGACTGCCCGCCGTTTGTCCCCGACTGCGTTAATTGCTCTCACG
CCTCCCCGCCCCGGGCATGGTTTTGATAGCCATGGTGGCGAACGTCTCATGGTGTCAGGGTCACCCGAGACTCAC
GGTCCGCCGGAGCCCGTCCTGATTGCTCCTGCACGACGTGAATCATCCAATGTAGTAGACTGGTCGGACTTATCG
GGTAACGAACTCGCATCACATTCGGATCTGTCCGATGACGAGGGGCAAAATCCGCATGGCGTTTCCCGGGAAAGC
CTTGGGATCCAGTCTGCTGCTGAGGCGGTCTCGACACCCCGAGGAGCAGGTCCGGTCGCTCGACCTCTCGCGAGG
CGCTCAGCCAGCCAGCTCAGCACACTGGATGACAAGAGCAGCGGCAACGGCAACAACAGCAAAACCAAAACCATC
AGTGTCGGCCATCTTGATCAGGATCCAGATCGGGTCGTCTGGCAAGGATGGCTTTGGATGCTACGGAGCAAGGGC
GGCGTACGGCAGTGGAAGCATCTTTGGGCGGTGCTGCGGCCGCGGATTCTCATTCTCTATAAGGACGAGTCTGAA
TACGCGGCACAATGGCTGGTGCAGCTCTCCGTCGTGGTCAACGTTGTGGATATTGACCCTCTCAGCAAGAGCAAG
AAGAACTGCCTTCAGGTCATTACGGAGGAGAAGAGCTACCGCTTCTGCGCTCACGATGAGGAGTCTCTTGTGCAC
CTCATTGGCGCCTTCAAGAGCCTACTTGCCAAACGGCGAGGCCTGGAGGCACACGGTGGATCAGGCTCACGCTTG
GAGGCACGCGGGACTGCCTGA
Transcript >Hirsu2|5018
ATGCCCGCCACCCAGGCCACCGATGTCGCGCCGCGGCTAAGCTCGAACCCCCAAAACGGATGTTTCGCCACAGGA
TCGGCATTGCGGAGTCGCTCAAACAGCCACGGCCTGGAGGCAAGCCTCAATGTAAACGGCTGTTTTGAGTCTGAT
CGCGTTACCAAGTGCGGCTATGTCAAGAGGCGGACACGGAAGACAAAGAAATGGAAGACTGCTTTTATCGTGTTG
CGGCGAAATACCCTATCCGTATATAAGAACGAGAAAGAGACGAAACTCCGCCACCAGGTCTACCTCTCAGACCTG
ACCGCGGTAGCCTTTCTCAAGGATCCCAAGCACAAGCGTGACAATGTGTTCGGGCTATTCTCTCCATCGAAGAAT
TTCCACCTCCAGGCATCCACAACAAAGGATGCCCAGGAGTGGGTCGACCTCATTCGCAAAGACGCGAGAATTGAA
GAGGAGGAGGAGGAGATGTTCCTTGCCAGCCCGACTGCCCGCCGTTTGTCCCCGACTGCGTTAATTGCTCTCACG
CCTCCCCGCCCCGGGCATGGTTTTGATAGCCATGGTGGCGAACGTCTCATGGTGTCAGGGTCACCCGAGACTCAC
GGTCCGCCGGAGCCCGTCCTGATTGCTCCTGCACGACGTGAATCATCCAATGTAGTAGACTGGTCGGACTTATCG
GGTAACGAACTCGCATCACATTCGGATCTGTCCGATGACGAGGGGCAAAATCCGCATGGCGTTTCCCGGGAAAGC
CTTGGGATCCAGTCTGCTGCTGAGGCGGTCTCGACACCCCGAGGAGCAGGTCCGGTCGCTCGACCTCTCGCGAGG
CGCTCAGCCAGCCAGCTCAGCACACTGGATGACAAGAGCAGCGGCAACGGCAACAACAGCAAAACCAAAACCATC
AGTGTCGGCCATCTTGATCAGGATCCAGATCGGGTCGTCTGGCAAGGATGGCTTTGGATGCTACGGAGCAAGGGC
GGCGTACGGCAGTGGAAGCATCTTTGGGCGGTGCTGCGGCCGCGGATTCTCATTCTCTATAAGGACGAGTCTGAA
TACGCGGCACAATGGCTGGTGCAGCTCTCCGTCGTGGTCAACGTTGTGGATATTGACCCTCTCAGCAAGAGCAAG
AAGAACTGCCTTCAGGTCATTACGGAGGAGAAGAGCTACCGCTTCTGCGCTCACGATGAGGAGTCTCTTGTGCAC
CTCATTGGCGCCTTCAAGAGCCTACTTGCCAAACGGCGAGGCCTGGAGGCACACGGTGGATCAGGCTCACGCTTG
GAGGCACGCGGGACTGCCTGA
Gene >Hirsu2|5018
ATGCCCGCCACCCAGGCCACCGATGTCGCGCCGCGGCTAAGCTCGAACCCCCAAAACGGATGTTTCGCCACAGGA
TCGGCATTGCGGAGTCGCTCAAACAGCCACGGCCTGGAGGCAAGCCTCAATGTAAACGGCTGTTTTGAGTCTGAT
CGCGTTACCAAGTGCGGCTATGTCAAGAGGCGGACACGGAAGACAAAGGTATTGTTGCCTTCCGTTGCATATTCC
ACAATCGCCTCCATCCGTACTGAGACAATTCTACATGTAGAAATGGAAGACTGCTTTTATCGTGTTGCGGCGAAA
TACCCTATCCGTATATAAGAACGAGAAAGAGACGAAACTCCGCCACCAGGTCTACCTCTCAGACCTGACCGCGGT
AGCCTTTCTCAAGGATCCCAAGCACAAGCGTGACAATGTGTTCGGGCTATTCTCTCCATCGAAGAATTTCCACCT
CCAGGCATCCACAACAAAGGATGCCCAGGAGTGGGTCGACCTCATTCGCAAAGACGCGAGAATTGAAGAGGAGGA
GGAGGAGATGTTCCTTGCCAGCCCGACTGCCCGCCGTTTGTCCCCGACTGCGTTAATTGCTCTCACGCCTCCCCG
CCCCGGGCATGGTTTTGATAGCCATGGTGGCGAACGTCTCATGGTGTCAGGGTCACCCGAGACTCACGGTCCGCC
GGAGCCCGTCCTGATTGCTCCTGCACGACGTGAATCATCCAATGTAGTAGACTGGTCGGACTTATCGGGTAACGA
ACTCGCATCACATTCGGATCTGTCCGATGACGAGGGGCAAAATCCGCATGGCGTTTCCCGGGAAAGCCTTGGGAT
CCAGTCTGCTGCTGAGGCGGTCTCGACACCCCGAGGAGCAGGTCCGGTCGCTCGACCTCTCGCGAGGCGCTCAGC
CAGCCAGCTCAGCACACTGGATGACAAGAGCAGCGGCAACGGCAACAACAGCAAAACCAAAACCATCAGTGTCGG
CCATCTTGATCAGGATCCAGATCGGGTCGTCTGGCAAGGATGGCTTTGGATGCTACGGAGCAAGGGCGGCGTACG
GCAGTGGAAGCATCTTTGGGCGGTGCTGCGGCCGCGGATTCTCATTCTCTATAAGGACGAGTCTGAATACGCGGC
ACAATGGCTGGTGCAGCTCTCCGTCGTGGTCAACGTTGTGGATATTGACCCTCTCAGCAAGAGCAAGAAGAACTG
CCTTCAGGTCATTACGGAGGAGAAGAGCTACCGCTTCTGCGCTCACGATGAGGAGTCTCTTGTGCACCTCATTGG
CGCCTTCAAGAGCCTACTTGCCAAACGGCGAGGCCTGGAGGCACACGGTGGATCAGGCTCACGCTTGGAGGCACG
CGGGACTGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail