Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5011
Gene name
LocationContig_251:4293..10295
Strand-
Gene length (bp)6002
Transcript length (bp)5727
Coding sequence length (bp)5727
Protein length (aa) 1909

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 8.2E-70 260 659
PF00501 AMP-binding AMP-binding enzyme 5.0E-18 1765 1883
PF00668 Condensation Condensation domain 7.8E-18 874 1046
PF00668 Condensation Condensation domain 3.5E-09 1131 1297
PF00668 Condensation Condensation domain 2.5E-29 1339 1716
PF00550 PP-binding Phosphopantetheine attachment site 4.0E-11 786 848

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 23 1908 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 51 1900 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 57 1709 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 222 1876 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 24 1633 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 23 1908 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 51 1900 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 57 1709 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 222 1876 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 24 1633 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 198 1887 0.0E+00
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 206 1290 1.0E-178
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 777 1861 8.0E-166
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 207 1907 7.0E-158
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 182 1882 7.0E-156
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 216 846 4.0E-155
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 190 1907 1.0E-149
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 252 1882 5.0E-140
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 222 1907 2.0E-137
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 184 930 7.0E-137
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 252 1908 3.0E-135
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 235 837 5.0E-130
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 252 1860 4.0E-129
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 252 1866 2.0E-128
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 54 1862 9.0E-128
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 188 1016 2.0E-123
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 57 1861 5.0E-122
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 235 846 7.0E-118
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 235 846 9.0E-118
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 234 1026 1.0E-117
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 57 851 6.0E-117
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 58 846 5.0E-113
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 252 842 6.0E-111
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 252 842 3.0E-110
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 244 842 3.0E-110
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 230 1303 2.0E-109
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 230 1303 8.0E-109
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 57 1066 3.0E-108
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 220 1127 4.0E-107
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 182 952 2.0E-105
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 247 1291 5.0E-105
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 190 1303 1.0E-101
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 57 846 1.0E-101
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 50 1303 2.0E-100
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 232 1293 2.0E-100
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 216 846 6.0E-95
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 242 1303 7.0E-95
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 28 848 1.0E-94
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 252 1296 1.0E-93
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 54 1290 2.0E-92
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 254 846 2.0E-91
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 252 1296 3.0E-90
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 253 1293 5.0E-88
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1336 1908 9.0E-87
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 27 838 1.0E-84
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 258 1290 2.0E-84
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 57 1016 2.0E-84
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 184 1290 2.0E-83
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 57 1043 2.0E-83
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 57 1043 2.0E-82
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 252 1034 1.0E-79
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 223 764 3.0E-79
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 245 1067 8.0E-79
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 218 1292 2.0E-78
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 56 1034 9.0E-78
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 252 1026 5.0E-77
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 56 1034 9.0E-77
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 18 1042 1.0E-76
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 187 1077 4.0E-76
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 57 854 4.0E-76
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1333 1908 2.0E-75
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 46 1019 6.0E-75
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 222 1025 2.0E-74
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 185 885 8.0E-74
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 254 1019 1.0E-73
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 255 1160 3.0E-73
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 46 1040 9.0E-73
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 258 1042 1.0E-72
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 218 1067 1.0E-72
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 252 1015 1.0E-72
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 207 1075 2.0E-72
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 57 1077 6.0E-72
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 190 851 7.0E-72
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 57 1025 1.0E-70
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 726 1861 1.0E-70
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 188 1046 6.0E-70
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 222 1025 2.0E-69
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 57 1043 4.0E-69
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 201 1019 2.0E-68
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 174 1067 3.0E-68
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 218 1075 4.0E-68
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 56 843 1.0E-67
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 57 1028 2.0E-67
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 252 1067 2.0E-67
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 167 1044 5.0E-67
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 184 1034 7.0E-67
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 253 1025 1.0E-65
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 256 858 1.0E-65
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 254 1296 2.0E-65
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 253 1025 2.0E-65
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 255 1191 2.0E-65
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 255 1191 2.0E-65
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 248 1217 2.0E-65
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 50 1042 2.0E-65
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 181 1294 6.0E-65
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 238 1022 7.0E-65
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 254 854 1.0E-64
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 252 822 1.0E-63
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 176 848 4.0E-63
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 253 1044 5.0E-63
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 57 1025 6.0E-63
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 57 1042 7.0E-63
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 252 1055 9.0E-63
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 185 848 2.0E-62
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 240 851 5.0E-62
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 226 1174 1.0E-61
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 185 857 2.0E-61
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 250 822 1.0E-60
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 187 851 7.0E-60
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 187 851 8.0E-60
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 241 1020 6.0E-59
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 260 1025 1.0E-58
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 185 846 2.0E-58
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 249 846 4.0E-58
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 179 827 6.0E-58
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 222 1029 2.0E-57
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 184 1043 7.0E-57
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 280 863 4.0E-56
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1338 1872 6.0E-56
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 224 1019 2.0E-55
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 224 1019 2.0E-55
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 218 1005 5.0E-54
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 255 861 4.0E-53
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 255 732 1.0E-52
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 178 871 3.0E-52
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1338 1877 4.0E-52
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 184 850 1.0E-51
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 268 1028 1.0E-51
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 1338 1877 5.0E-51
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1335 1907 2.0E-50
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 257 756 3.0E-50
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 1338 1877 6.0E-50
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1327 1714 1.0E-49
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 213 858 2.0E-49
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 280 853 9.0E-49
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 237 854 9.0E-49
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 1338 1877 1.0E-48
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 188 1036 2.0E-48
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 237 854 3.0E-48
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 237 854 3.0E-47
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 255 846 7.0E-47
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 255 1235 2.0E-46
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 252 886 2.0E-46
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 257 754 1.0E-45
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 257 754 1.0E-45
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 257 754 1.0E-45
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 257 754 1.0E-45
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 257 754 1.0E-45
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 257 754 2.0E-45
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 257 754 2.0E-45
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 257 754 2.0E-45
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 257 754 2.0E-45
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 257 754 2.0E-45
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 257 754 2.0E-45
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 257 754 3.0E-45
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 257 754 9.0E-45
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 257 754 1.0E-44
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 257 754 2.0E-44
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 257 754 3.0E-44
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 247 854 2.0E-43
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 255 822 8.0E-43
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 255 822 9.0E-43
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 259 756 3.0E-42
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 1338 1907 4.0E-42
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 279 1225 9.0E-42
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1295 1864 1.0E-41
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 254 855 1.0E-41
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1522 1862 6.0E-41
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 250 847 1.0E-40
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1337 1861 4.0E-40
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 279 1029 1.0E-39
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 259 756 1.0E-39
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 242 846 2.0E-39
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 242 846 2.0E-39
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 242 846 2.0E-39
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1338 1861 4.0E-39
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 242 846 4.0E-38
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 279 846 5.0E-38
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 254 846 1.0E-37
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 190 757 1.0E-37
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 257 754 4.0E-37
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 257 754 7.0E-37
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 174 843 1.0E-36
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 254 828 1.0E-36
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 257 756 3.0E-36
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 257 754 4.0E-36
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 252 669 6.0E-36
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 257 754 1.0E-35
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 1337 1861 2.0E-35
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 566 1047 2.0E-35
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 60 843 3.0E-35
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 257 754 5.0E-35
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 1338 1861 7.0E-35
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 274 1127 2.0E-34
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1336 1898 2.0E-34
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 250 754 1.0E-33
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 259 754 1.0E-33
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1336 1860 3.0E-33
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 257 754 3.0E-33
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 257 754 3.0E-33
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 1330 1863 7.0E-33
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 257 754 1.0E-32
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 257 754 1.0E-32
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 257 754 1.0E-32
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 257 754 1.0E-32
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 259 754 3.0E-32
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 257 754 4.0E-32
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 259 754 5.0E-32
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 257 754 6.0E-32
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 1338 1860 9.0E-32
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 249 855 1.0E-31
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 257 756 1.0E-31
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1330 1907 3.0E-31
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1366 1907 3.0E-31
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 255 757 3.0E-31
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 242 816 4.0E-31
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1330 1907 5.0E-31
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 1336 1861 8.0E-31
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 280 860 1.0E-30
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 258 756 1.0E-30
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 255 757 2.0E-30
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 259 754 7.0E-30
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 259 754 9.0E-30
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 259 754 9.0E-30
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 259 754 9.0E-30
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 263 757 9.0E-30
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 259 754 9.0E-30
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 259 754 9.0E-30
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 259 754 9.0E-30
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 259 754 9.0E-30
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 263 757 1.0E-29
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 263 757 1.0E-29
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 263 757 1.0E-29
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 263 757 1.0E-29
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 259 754 1.0E-29
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 259 754 1.0E-29
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 259 754 1.0E-29
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 263 757 1.0E-29
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 263 757 1.0E-29
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 263 757 1.0E-29
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 263 757 1.0E-29
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 277 754 3.0E-29
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 277 754 3.0E-29
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 277 754 3.0E-29
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1714 1904 3.0E-29
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 1332 1861 4.0E-29
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1305 1896 4.0E-29
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 263 757 5.0E-29
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 263 757 5.0E-29
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 263 757 5.0E-29
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 263 757 5.0E-29
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 263 757 5.0E-29
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 263 757 5.0E-29
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1377 1861 5.0E-29
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1735 1908 5.0E-29
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 277 754 7.0E-29
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1334 1907 3.0E-28
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 1384 1866 3.0E-28
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1366 1861 9.0E-28
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1366 1884 1.0E-27
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 237 839 2.0E-27
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 1335 1860 2.0E-27
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 1703 1882 2.0E-27
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 1338 1866 3.0E-27
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1368 1861 3.0E-27
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 1339 1861 5.0E-27
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1337 1780 1.0E-26
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1370 1883 1.0E-26
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1292 1863 2.0E-26
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1290 1907 2.0E-26
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 1342 1860 3.0E-25
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1290 1861 4.0E-25
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1341 1907 6.0E-25
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 1290 1869 7.0E-25
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 255 756 9.0E-25
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1336 1907 1.0E-24
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1292 1863 2.0E-24
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 1341 1907 2.0E-24
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 221 669 1.0E-23
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1379 1894 1.0E-23
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 1716 1862 2.0E-23
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1363 1895 3.0E-23
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1334 1908 3.0E-23
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1471 1861 4.0E-23
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1327 1907 7.0E-23
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 1757 1862 1.0E-22
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 322 700 2.0E-22
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 1339 1907 3.0E-22
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 1342 1907 6.0E-22
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1377 1861 7.0E-22
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 1292 1867 2.0E-21
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1338 1860 2.0E-21
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1379 1859 2.0E-21
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 317 824 3.0E-21
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1377 1861 4.0E-21
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1379 1861 7.0E-21
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 253 821 9.0E-21
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 1340 1864 9.0E-21
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1474 1907 2.0E-20
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 1757 1862 3.0E-20
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1337 1642 3.0E-20
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 1757 1862 3.0E-20
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1379 1863 2.0E-19
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1336 1862 2.0E-19
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1459 1861 2.0E-19
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 259 757 3.0E-19
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 1337 1861 4.0E-19
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 1759 1880 5.0E-19
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1368 1864 8.0E-19
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1474 1863 1.0E-18
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1474 1863 1.0E-18
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1731 1868 1.0E-18
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 253 765 2.0E-18
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 253 765 2.0E-18
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1471 1861 2.0E-18
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1368 1860 2.0E-18
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 1472 1863 3.0E-18
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 296 770 4.0E-18
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 1370 1888 4.0E-18
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 1377 1907 1.0E-17
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 1561 1872 1.0E-17
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1473 1682 2.0E-17
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 1339 1861 3.0E-17
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 1339 1860 4.0E-17
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 1474 1907 4.0E-17
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1339 1870 5.0E-17
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1339 1870 5.0E-17
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 1710 1860 9.0E-17
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 272 757 3.0E-16
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 1339 1880 6.0E-16
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1656 1878 1.0E-15
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1656 1878 1.0E-15
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 259 756 2.0E-15
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 1333 1863 2.0E-15
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 259 756 3.0E-15
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 259 756 3.0E-15
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1336 1695 3.0E-15
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1733 1899 4.0E-15
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 1556 1861 6.0E-15
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 1724 1862 9.0E-15
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 395 755 2.0E-14
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1317 1865 2.0E-14
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 244 754 3.0E-14
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1338 1863 3.0E-14
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 400 823 5.0E-14
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 400 823 6.0E-14
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 1752 1907 1.0E-13
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 253 760 1.0E-13
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1336 1861 1.0E-13
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 260 756 3.0E-13
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 259 754 3.0E-13
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 384 752 3.0E-13
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 1754 1908 4.0E-13
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1365 1908 5.0E-13
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 264 760 5.0E-13
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 1468 1907 1.0E-12
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 264 760 2.0E-12
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1368 1661 2.0E-12
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1341 1679 3.0E-12
sp|B2HIN2|FAA26_MYCMM Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD26 PE=3 SV=1 249 751 4.0E-12
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 1738 1907 5.0E-12
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 1738 1907 6.0E-12
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 386 755 7.0E-12
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1341 1908 8.0E-12
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1341 1908 8.0E-12
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1327 1664 1.0E-11
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 1680 1862 1.0E-11
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 371 755 2.0E-11
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 1680 1862 2.0E-11
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1755 1860 2.0E-11
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 1335 1679 3.0E-11
sp|P54200|FAD21_MYCLE Putative fatty-acid--CoA ligase fadD21 OS=Mycobacterium leprae (strain TN) GN=fadD21 PE=3 SV=2 252 751 3.0E-11
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 251 757 5.0E-11
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 1335 1862 5.0E-11
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1732 1861 5.0E-11
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 255 669 6.0E-11
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 1715 1906 6.0E-11
sp|O07619|YHFT_BACSU Uncharacterized acyl--CoA ligase YhfT OS=Bacillus subtilis (strain 168) GN=yhfT PE=2 SV=1 263 756 7.0E-11
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 266 760 8.0E-11
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 1680 1862 9.0E-11
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 395 756 1.0E-10
sp|Q91VE0|S27A4_MOUSE Long-chain fatty acid transport protein 4 OS=Mus musculus GN=Slc27a4 PE=1 SV=1 258 758 1.0E-10
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 1333 1680 1.0E-10
sp|P9WQ55|FAD10_MYCTU Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 249 751 2.0E-10
sp|P9WQ54|FAD10_MYCTO Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 249 751 2.0E-10
sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 264 771 2.0E-10
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 401 760 2.0E-10
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 628 851 2.0E-10
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 395 755 3.0E-10
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 1342 1860 3.0E-10
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 395 757 5.0E-10
sp|Q9VLL0|ACSF4_DROME Acyl-CoA synthetase family member 4 homolog OS=Drosophila melanogaster GN=U26 PE=2 SV=3 393 822 5.0E-10
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 251 756 5.0E-10
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1317 1716 8.0E-10
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 251 756 9.0E-10
sp|P9WQ51|FAC19_MYCTU Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD19 PE=1 SV=1 250 432 1.0E-09
sp|P9WQ50|FAC19_MYCTO Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD19 PE=3 SV=1 250 432 1.0E-09
sp|Q7TWB7|FAC19_MYCBO Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD19 PE=3 SV=1 250 432 1.0E-09
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 395 755 2.0E-09
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 365 756 2.0E-09
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 365 756 2.0E-09
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 276 756 2.0E-09
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 276 756 2.0E-09
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 280 755 2.0E-09
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 748 1029 2.0E-09
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 1762 1902 2.0E-09
sp|P59871|ACSA_MYCBO Acetyl-coenzyme A synthetase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=acsA PE=3 SV=1 241 771 3.0E-09
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 254 755 3.0E-09
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 280 755 3.0E-09
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 280 755 3.0E-09
sp|Q8FLA5|CAIC_ECOL6 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 280 755 3.0E-09
sp|Q0TLV2|CAIC_ECOL5 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 280 755 3.0E-09
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 395 757 3.0E-09
sp|P9WQD1|ACSA_MYCTU Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=acsA PE=1 SV=1 241 771 3.0E-09
sp|P9WQD0|ACSA_MYCTO Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=acsA PE=3 SV=1 241 771 3.0E-09
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 229 755 3.0E-09
sp|Q1RGG1|CAIC_ECOUT Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 280 755 3.0E-09
sp|A1A787|CAIC_ECOK1 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O1:K1 / APEC GN=caiC PE=3 SV=2 280 755 3.0E-09
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 280 755 4.0E-09
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 1718 1849 4.0E-09
sp|B7MNP4|CAIC_ECO81 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O81 (strain ED1a) GN=caiC PE=3 SV=2 280 755 6.0E-09
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 401 766 7.0E-09
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1344 1703 7.0E-09
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 403 756 8.0E-09
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 398 756 9.0E-09
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 389 762 9.0E-09
sp|A7ZVY7|CAIC_ECOHS Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 280 755 9.0E-09
sp|B7M0D4|CAIC_ECO8A Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O8 (strain IAI1) GN=caiC PE=3 SV=2 280 755 9.0E-09
sp|P97849|S27A1_RAT Long-chain fatty acid transport protein 1 OS=Rattus norvegicus GN=Slc27a1 PE=2 SV=1 268 758 1.0E-08
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 386 757 1.0E-08
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 386 765 1.0E-08
sp|B5YYD1|CAIC_ECO5E Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiC PE=3 SV=1 280 755 1.0E-08
sp|Q8XA34|CAIC_ECO57 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 GN=caiC PE=3 SV=2 280 755 1.0E-08
sp|Q3Z5X2|CAIC_SHISS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella sonnei (strain Ss046) GN=caiC PE=3 SV=2 280 755 1.0E-08
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1329 1694 1.0E-08
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 1372 1661 1.0E-08
sp|B6HYY8|CAIC_ECOSE Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SE11) GN=caiC PE=3 SV=2 280 755 2.0E-08
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 265 755 2.0E-08
sp|B1IRD9|CAIC_ECOLC Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 280 755 2.0E-08
sp|B4EY25|CAIC_PROMH Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 278 755 2.0E-08
sp|Q3ZKN0|S27A1_BOVIN Long-chain fatty acid transport protein 1 OS=Bos taurus GN=SLC27A1 PE=2 SV=1 280 758 2.0E-08
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1338 1661 3.0E-08
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 280 755 3.0E-08
sp|B2HI05|FAC19_MYCMM Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD19 PE=3 SV=1 250 432 3.0E-08
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 399 756 4.0E-08
sp|Q60714|S27A1_MOUSE Long-chain fatty acid transport protein 1 OS=Mus musculus GN=Slc27a1 PE=1 SV=1 254 758 4.0E-08
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 403 756 5.0E-08
sp|Q6PCB7|S27A1_HUMAN Long-chain fatty acid transport protein 1 OS=Homo sapiens GN=SLC27A1 PE=2 SV=1 251 758 5.0E-08
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 528 846 6.0E-08
sp|Q9L9F6|NOVL_STRNV 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 265 759 6.0E-08
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 569 762 6.0E-08
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 385 754 8.0E-08
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 397 754 8.0E-08
sp|Q6SKG1|ACSM3_RAT Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 396 755 9.0E-08
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 365 756 9.0E-08
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 718 846 1.0E-07
sp|P31552|CAIC_ECOLI Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12) GN=caiC PE=1 SV=2 280 755 1.0E-07
sp|B1XBG2|CAIC_ECODH Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / DH10B) GN=caiC PE=3 SV=2 280 755 1.0E-07
sp|C4ZPW3|CAIC_ECOBW Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiC PE=3 SV=2 280 755 1.0E-07
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 399 756 2.0E-07
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 395 761 2.0E-07
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 401 762 2.0E-07
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 399 756 3.0E-07
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 585 765 4.0E-07
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 573 756 5.0E-07
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 401 669 6.0E-07
sp|B2HIL6|FAA22_MYCMM p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD22 PE=1 SV=1 279 790 7.0E-07
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 718 846 9.0E-07
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 403 756 9.0E-07
sp|Q8KBY0|ACSA_CHLTE Acetyl-coenzyme A synthetase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=acsA PE=3 SV=2 630 760 1.0E-06
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 401 760 1.0E-06
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 403 756 1.0E-06
sp|Q42524|4CL1_ARATH 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 394 755 1.0E-06
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 383 755 1.0E-06
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1731 1860 2.0E-06
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 247 758 2.0E-06
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 395 755 3.0E-06
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 395 755 3.0E-06
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 722 1036 6.0E-06
sp|E3UUE6|FAC19_RHORH 3-oxocholest-4-en-26-oate--CoA ligase OS=Rhodococcus rhodochrous GN=fadD19 PE=1 SV=1 255 420 9.0E-06
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1379 1698 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 1819 1838 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5011
MASAIKQKLEWRPSSAADHDCAPALPPLPQQPAADEAVELEFPWPQERPTDSRMLLLVRAAWAVVVGRETNSKDV
VFGGAEPERSTTTSATGTTNGETAVQETEPAAVHVQWTSDQKVTDYLEAVQQLFEPTQCPGESPSSRQYQTCTLR
TTCMLPVRTQQQRSAADDLGVPRTHAVVLEAQLGQEIKVTARFDQRLMQARTGLSLLQRLACVAGQLAAAAPEQA
VKEMETATGRDIQQVWAWNGEVPPAVDRCVHELVEEQARARPDAVAVCAWDGELTYGELDRLAARVAGDLVGRGV
GPDSLVPLCFEKSKWTTVAMLAVLKAGGGFVLLDASLPEQRLRNIVDQADARLLLSSPSRLALSSRLAPVVLLIS
SDSFAHPGNQPDRPLPLPSPSSVMYLVFTSGSTGNPKGVIVTHRNFSTAVLYQAPDLGLSAESRVFDFASYAFDA
SVSDTFLVLATGGCLCVPSDQDRAGNISLSIASLKANVVDVPPSVAPFLIPQELPDVQTLIFSGEALHTRHFHRW
WDRARIINVYGPAECSPISLVNGEASSPEAAVRIGRGSGAVTWVVDPDNYDCLLPVGCVGELLLEGPLLGRGYLH
EPAKTAAAFIHDPAWLLRGAPGRPGRHGRLYRTGDLVRYNEDDGSLSFVGRRDEQVKIRGQRVELGEVEHRVHEC
LPQARQVVAEVVAPEGSSAALAAFLEMPDERSAARLLPADADVEDRLGKLLPSYMMPSIFMALPEMPKTASGKID
RRRLREMGASLSAQQLADTRTTSGTKRAPVSKTEQQMQAIWAQVLNIDQATVGLDDSFLRLGGDSITAMQVASAA
RSRHIHVSVADILGKKTISKLVDGLEPSSVGEPVSRALVSHETLGGRSMQLSPIQNLYVQLQPDPTKCCFDQNFF
LSVNGRITRDSLSAALETIVRRHTVFCARFTRNQEGMWEQRITPDASASFRLFVDESGADKTAHAIAQCRDSLNL
EDGPLFAALLFDDPAATQRLFLTMPHSIVDLVSWRVLLRELEALLTSGTLTMPPPLGFQSWTALQAEYAAEKLDP
AVTAPTEVRPPLLEYWGMDVKENLEGGAVFKRSTLDVATSSAILNGCNDALSTRPLELMIAALLHAFGLVFSDRP
LPPIFSEGHGREPWDDSIDISATVGWFTTLWPVQISSGKNASLIDTIRRTKDCVRALPRKGWSWFTSRFADAEKA
ARFASGFPVEILFNYQGLYQQLERSDAIFEQIDLPHGSAPASSSAVQRFAFFEIDARVERGRIVTSVAYHKEMGH
QQRIAEWVEKYEETLVQMSKELPEMLPSWTLMEFPAVFSSYEDIEEFQNVWLDRLGILRLEDVEDIFPCSPMQEA
ILVSQAKDSNNYRPWSLYEIKVRGEGARLDMARLQQAWQAVVRRHGLMRAIFVDGLPGSDGTMHVVLRDPSPSIS
VLEEAGEAMVSRLRNMDDTGASYPKLGLQHHVTICQLDAATAYMRLDINHTISDGFSQDLVLRDLQAAYHGSLGP
AGTYRDFVACLAEQPKDAGIEFWSGRLAGVEPCLFPALGGDDIDRAAAEAVSVKVPNLDAGKIRAFCTRWTLTAA
TLTQTAWALVLSKYTGATMPCFGNLYSGRDVPVHKAETISGPLMGMAPCRVLIDRSKSVLDTLTKVQEDFLGSMA
FQHVPLAAIHRALGLGTSALFNSTLSFQRPDDEGRVGADSVVVRNVYECDPTEYDVTISAFDRGCLSQAVSEIIS
DPTRSLGELDLLGPSDLEQIWGWNKTLPEPAEQCVHEMVKAKAQAHPDAPAICAWDGNLTYGELDLLASRLARRL
VDSGVEPGMMLALCFDKSMWTTVAILGVMMAGGSFVLLDPSLPEQRLQFACQKARANLILSSTANQTLSLRLCQK
VVAFDSDFFDQLDKTASSIDDLPSVDLDSIIYL*
Coding >Hirsu2|5011
ATGGCTTCCGCAATCAAACAAAAACTGGAGTGGCGGCCGAGCTCGGCGGCGGACCATGACTGCGCACCGGCTCTT
CCGCCGCTGCCGCAGCAGCCGGCGGCCGACGAGGCAGTCGAGCTTGAATTCCCCTGGCCACAGGAACGGCCGACG
GACTCGAGGATGCTGCTGCTGGTCCGGGCGGCGTGGGCCGTCGTCGTCGGCCGCGAAACCAACTCCAAGGACGTC
GTGTTCGGCGGCGCCGAACCGGAGCGGAGCACCACCACATCCGCGACCGGCACCACGAACGGCGAGACGGCAGTC
CAGGAAACGGAGCCGGCCGCCGTTCATGTGCAGTGGACGAGCGACCAGAAGGTGACGGACTATCTCGAAGCAGTC
CAACAACTTTTCGAGCCGACTCAATGTCCGGGCGAAAGCCCTTCGAGCCGGCAATATCAAACATGTACTCTGCGC
ACCACATGTATGCTCCCGGTCCGGACGCAGCAGCAGCGTTCCGCGGCGGACGATCTCGGGGTTCCCCGCACGCAC
GCTGTCGTGCTCGAGGCGCAGCTCGGTCAAGAAATCAAAGTCACCGCTCGCTTCGACCAGAGACTCATGCAGGCC
CGGACCGGCCTCAGTCTGCTGCAGCGTCTAGCGTGCGTGGCGGGACAGCTAGCCGCCGCGGCGCCGGAGCAGGCG
GTGAAGGAGATGGAGACGGCCACGGGGCGTGACATCCAGCAGGTCTGGGCGTGGAACGGCGAGGTCCCGCCGGCG
GTGGACCGGTGTGTCCACGAGCTGGTCGAGGAGCAGGCCCGGGCCCGCCCCGACGCCGTCGCCGTCTGCGCCTGG
GACGGCGAGCTGACGTACGGCGAGCTGGACCGGCTGGCGGCGCGCGTCGCCGGCGACCTCGTCGGCCGCGGCGTC
GGGCCGGACTCGCTCGTGCCGCTCTGCTTCGAGAAGTCGAAGTGGACGACGGTCGCGATGCTGGCCGTGCTCAAG
GCCGGCGGCGGCTTCGTGCTGCTGGACGCCTCGCTGCCGGAGCAGCGCCTCCGGAACATCGTCGACCAGGCCGAC
GCCCGCCTCCTCCTCTCTTCCCCCTCCCGTCTGGCCCTGAGCTCGCGCCTGGCGCCTGTGGTTCTCCTCATCAGT
TCCGACTCCTTCGCCCATCCCGGCAACCAGCCGGATCGGCCCCTGCCACTCCCTTCCCCCTCGTCTGTCATGTAT
CTGGTCTTTACGTCTGGGAGCACGGGCAATCCCAAAGGCGTAATCGTAACCCACCGGAACTTCTCCACGGCCGTC
TTATACCAGGCACCGGACCTCGGCCTCTCCGCCGAGTCGAGGGTCTTCGACTTCGCGTCCTATGCGTTCGACGCC
TCCGTCAGCGATACCTTTCTCGTCCTCGCCACAGGGGGCTGCCTATGCGTGCCCAGCGACCAGGACCGGGCGGGC
AACATCTCGCTCAGCATAGCGTCTCTGAAGGCCAACGTCGTAGACGTGCCCCCGTCTGTCGCCCCCTTTCTCATT
CCCCAAGAGCTGCCGGACGTGCAAACTCTCATCTTTTCCGGCGAGGCCTTGCATACAAGGCACTTCCATCGATGG
TGGGACAGGGCGCGCATCATCAACGTCTACGGCCCTGCCGAATGCTCGCCCATCAGCCTCGTCAACGGCGAGGCG
TCGAGCCCGGAGGCGGCCGTCCGGATCGGCCGAGGCAGTGGTGCGGTCACGTGGGTCGTGGACCCCGACAACTAC
GACTGCCTGCTGCCGGTTGGCTGCGTCGGCGAGCTGCTCCTCGAAGGGCCGCTCCTCGGGCGCGGCTATCTGCAC
GAGCCGGCGAAAACGGCGGCCGCCTTCATCCACGACCCGGCATGGCTCCTGCGCGGTGCTCCGGGCCGGCCCGGA
CGCCACGGCCGCCTCTACCGGACCGGCGACCTCGTCCGGTACAACGAGGACGACGGCAGCCTGAGCTTCGTCGGC
CGCCGCGACGAGCAGGTCAAGATCCGCGGCCAGCGCGTCGAGCTGGGAGAGGTCGAGCACCGCGTTCACGAGTGC
CTGCCGCAGGCGAGGCAGGTTGTCGCCGAGGTCGTCGCGCCCGAGGGCTCGTCTGCCGCCCTGGCCGCCTTCCTC
GAGATGCCCGACGAGCGCTCCGCGGCCCGCCTCCTCCCGGCCGATGCCGACGTCGAGGACCGGCTGGGCAAGCTC
CTGCCGTCGTACATGATGCCGTCCATCTTCATGGCCTTGCCGGAGATGCCGAAAACGGCCTCGGGCAAGATAGAC
CGCAGGCGGCTGCGCGAGATGGGCGCGTCGCTCTCCGCCCAGCAGCTGGCCGACACGCGGACGACCTCGGGCACC
AAGAGGGCGCCCGTGTCCAAGACGGAGCAGCAGATGCAGGCCATCTGGGCCCAGGTGCTCAACATCGACCAGGCG
ACGGTCGGGCTGGACGACAGCTTCCTGCGCCTGGGAGGTGACTCCATCACGGCCATGCAGGTGGCGTCGGCGGCG
CGCTCGCGCCACATCCACGTCAGCGTCGCCGACATCCTGGGCAAGAAGACCATTTCCAAGCTTGTCGACGGCCTC
GAGCCGTCGTCCGTGGGCGAGCCGGTCAGCCGCGCGCTCGTCAGCCACGAGACGCTCGGCGGCCGGTCGATGCAG
CTGAGTCCGATCCAGAACCTCTACGTCCAGCTGCAGCCGGACCCGACCAAGTGCTGCTTCGACCAGAACTTCTTC
CTCAGCGTCAACGGCAGGATCACTCGTGACTCTCTCTCGGCCGCCCTCGAGACCATCGTCCGCAGGCACACCGTT
TTCTGTGCGCGTTTCACCAGGAACCAAGAGGGCATGTGGGAGCAGCGCATCACCCCCGACGCCTCGGCCTCGTTC
CGTCTGTTCGTCGACGAGTCCGGAGCGGACAAGACGGCCCATGCCATCGCCCAATGCCGCGACAGCCTGAACCTC
GAGGACGGGCCGCTGTTTGCTGCCCTGCTCTTCGACGACCCGGCCGCAACTCAGAGGCTATTCCTCACTATGCCA
CACTCCATAGTCGACCTGGTATCCTGGCGGGTCTTGCTCCGAGAGCTCGAGGCACTCTTGACATCGGGAACCCTC
ACTATGCCGCCGCCCCTGGGATTTCAGTCTTGGACCGCTCTTCAAGCCGAGTATGCTGCTGAGAAGCTGGATCCC
GCGGTCACGGCTCCGACCGAAGTCCGGCCACCTCTTCTCGAATACTGGGGAATGGATGTTAAGGAGAACCTTGAA
GGGGGCGCTGTCTTCAAGCGCTCCACCCTCGATGTGGCAACCAGCTCGGCGATCCTCAACGGCTGCAACGATGCC
CTGTCCACGCGCCCGCTCGAGCTCATGATAGCGGCACTGCTTCACGCCTTCGGCCTCGTCTTTTCCGACCGACCC
CTCCCCCCAATCTTCAGCGAGGGCCACGGTCGCGAGCCGTGGGATGACAGCATCGACATTTCTGCGACAGTTGGC
TGGTTCACGACGCTGTGGCCGGTGCAGATATCTTCCGGCAAGAACGCCAGCCTGATAGACACCATCCGCCGGACC
AAGGACTGCGTTCGAGCCTTGCCCCGAAAGGGCTGGTCGTGGTTTACGTCTCGTTTTGCGGATGCGGAGAAGGCG
GCCCGGTTTGCCTCGGGGTTCCCGGTCGAGATTCTCTTCAACTACCAAGGGCTTTACCAGCAGCTGGAGCGCAGT
GACGCTATCTTCGAGCAGATTGACCTGCCCCATGGATCTGCCCCGGCATCGAGCTCCGCGGTGCAGAGGTTCGCA
TTCTTCGAAATAGACGCCCGAGTCGAAAGGGGACGCATCGTCACATCAGTCGCTTACCATAAGGAGATGGGTCAT
CAGCAAAGAATCGCCGAATGGGTTGAAAAGTACGAGGAGACGCTTGTCCAGATGTCGAAAGAGCTCCCGGAAATG
CTTCCCAGCTGGACTCTCATGGAATTCCCTGCCGTCTTCTCCTCATACGAAGACATCGAGGAGTTCCAAAACGTG
TGGCTGGACCGACTCGGCATCCTTCGATTGGAGGACGTGGAAGACATCTTCCCCTGCTCGCCGATGCAAGAGGCC
ATATTGGTCAGCCAGGCCAAGGACTCGAATAACTATAGGCCATGGTCTCTCTACGAAATCAAAGTCAGAGGAGAG
GGCGCCCGGCTTGACATGGCCAGGCTCCAGCAGGCCTGGCAGGCTGTTGTGAGGCGGCATGGGCTCATGCGGGCC
ATTTTTGTCGACGGGCTCCCCGGGAGCGACGGGACCATGCATGTCGTCCTCCGCGACCCAAGCCCGAGCATATCT
GTCTTGGAAGAGGCCGGCGAGGCCATGGTGAGCAGGCTGCGGAACATGGATGACACGGGTGCATCCTATCCGAAA
CTTGGGTTGCAACATCATGTCACCATTTGCCAGCTGGACGCAGCAACGGCCTACATGCGGCTCGACATCAACCAC
ACCATCTCGGACGGCTTCTCGCAGGACCTGGTCCTGCGCGATCTTCAGGCGGCCTATCATGGCAGTCTTGGCCCG
GCTGGGACCTACCGCGACTTCGTCGCCTGTCTGGCAGAGCAGCCCAAGGACGCTGGGATCGAGTTCTGGTCCGGT
CGACTGGCCGGCGTTGAGCCATGCCTCTTCCCGGCTTTAGGAGGAGATGATATCGACCGCGCCGCTGCCGAAGCC
GTATCCGTCAAGGTTCCCAATCTCGACGCGGGCAAGATACGCGCCTTCTGCACGCGATGGACGCTGACGGCCGCA
ACACTGACGCAGACAGCGTGGGCGCTGGTGCTGAGCAAGTACACCGGGGCAACGATGCCGTGCTTTGGGAATCTA
TACTCAGGCCGAGACGTCCCGGTACACAAGGCTGAGACCATCTCCGGGCCCTTGATGGGCATGGCGCCCTGCCGA
GTACTGATTGACAGGTCGAAATCGGTGCTGGATACTCTGACAAAGGTCCAGGAGGATTTCCTCGGCAGCATGGCC
TTCCAGCACGTTCCTTTAGCCGCAATCCACAGGGCTCTTGGGCTTGGGACTTCCGCGCTTTTCAACAGCACATTG
TCCTTCCAGAGACCCGACGACGAGGGCCGAGTTGGCGCTGACAGCGTCGTCGTGAGAAACGTTTATGAGTGTGAC
CCGACCGAGTATGACGTGACTATCAGTGCTTTCGACAGAGGCTGCCTCTCCCAGGCGGTTTCTGAGATCATAAGC
GACCCCACACGCAGCCTCGGGGAGCTCGACCTGCTGGGGCCCTCCGACCTGGAGCAAATATGGGGATGGAACAAG
ACCCTTCCAGAACCGGCCGAGCAATGCGTCCACGAGATGGTCAAGGCCAAAGCCCAGGCTCACCCCGATGCCCCG
GCGATCTGTGCGTGGGACGGCAACCTGACATACGGCGAGCTGGACCTCCTAGCTTCGAGGTTGGCAAGACGGCTT
GTTGATTCCGGTGTCGAGCCGGGAATGATGCTGGCGTTATGCTTCGACAAGTCTATGTGGACGACGGTCGCGATA
CTCGGCGTAATGATGGCCGGGGGGTCCTTTGTGCTACTGGACCCATCACTTCCGGAGCAACGACTTCAGTTCGCT
TGCCAAAAGGCCAGAGCAAACTTGATTCTCTCGTCCACCGCCAACCAGACACTCAGCTTGCGGCTGTGCCAAAAA
GTGGTCGCCTTCGACTCCGACTTCTTCGACCAGCTCGACAAGACTGCTTCCTCGATAGATGACCTGCCAAGTGTC
GACCTAGACTCCATCATCTACCTTTGA
Transcript >Hirsu2|5011
ATGGCTTCCGCAATCAAACAAAAACTGGAGTGGCGGCCGAGCTCGGCGGCGGACCATGACTGCGCACCGGCTCTT
CCGCCGCTGCCGCAGCAGCCGGCGGCCGACGAGGCAGTCGAGCTTGAATTCCCCTGGCCACAGGAACGGCCGACG
GACTCGAGGATGCTGCTGCTGGTCCGGGCGGCGTGGGCCGTCGTCGTCGGCCGCGAAACCAACTCCAAGGACGTC
GTGTTCGGCGGCGCCGAACCGGAGCGGAGCACCACCACATCCGCGACCGGCACCACGAACGGCGAGACGGCAGTC
CAGGAAACGGAGCCGGCCGCCGTTCATGTGCAGTGGACGAGCGACCAGAAGGTGACGGACTATCTCGAAGCAGTC
CAACAACTTTTCGAGCCGACTCAATGTCCGGGCGAAAGCCCTTCGAGCCGGCAATATCAAACATGTACTCTGCGC
ACCACATGTATGCTCCCGGTCCGGACGCAGCAGCAGCGTTCCGCGGCGGACGATCTCGGGGTTCCCCGCACGCAC
GCTGTCGTGCTCGAGGCGCAGCTCGGTCAAGAAATCAAAGTCACCGCTCGCTTCGACCAGAGACTCATGCAGGCC
CGGACCGGCCTCAGTCTGCTGCAGCGTCTAGCGTGCGTGGCGGGACAGCTAGCCGCCGCGGCGCCGGAGCAGGCG
GTGAAGGAGATGGAGACGGCCACGGGGCGTGACATCCAGCAGGTCTGGGCGTGGAACGGCGAGGTCCCGCCGGCG
GTGGACCGGTGTGTCCACGAGCTGGTCGAGGAGCAGGCCCGGGCCCGCCCCGACGCCGTCGCCGTCTGCGCCTGG
GACGGCGAGCTGACGTACGGCGAGCTGGACCGGCTGGCGGCGCGCGTCGCCGGCGACCTCGTCGGCCGCGGCGTC
GGGCCGGACTCGCTCGTGCCGCTCTGCTTCGAGAAGTCGAAGTGGACGACGGTCGCGATGCTGGCCGTGCTCAAG
GCCGGCGGCGGCTTCGTGCTGCTGGACGCCTCGCTGCCGGAGCAGCGCCTCCGGAACATCGTCGACCAGGCCGAC
GCCCGCCTCCTCCTCTCTTCCCCCTCCCGTCTGGCCCTGAGCTCGCGCCTGGCGCCTGTGGTTCTCCTCATCAGT
TCCGACTCCTTCGCCCATCCCGGCAACCAGCCGGATCGGCCCCTGCCACTCCCTTCCCCCTCGTCTGTCATGTAT
CTGGTCTTTACGTCTGGGAGCACGGGCAATCCCAAAGGCGTAATCGTAACCCACCGGAACTTCTCCACGGCCGTC
TTATACCAGGCACCGGACCTCGGCCTCTCCGCCGAGTCGAGGGTCTTCGACTTCGCGTCCTATGCGTTCGACGCC
TCCGTCAGCGATACCTTTCTCGTCCTCGCCACAGGGGGCTGCCTATGCGTGCCCAGCGACCAGGACCGGGCGGGC
AACATCTCGCTCAGCATAGCGTCTCTGAAGGCCAACGTCGTAGACGTGCCCCCGTCTGTCGCCCCCTTTCTCATT
CCCCAAGAGCTGCCGGACGTGCAAACTCTCATCTTTTCCGGCGAGGCCTTGCATACAAGGCACTTCCATCGATGG
TGGGACAGGGCGCGCATCATCAACGTCTACGGCCCTGCCGAATGCTCGCCCATCAGCCTCGTCAACGGCGAGGCG
TCGAGCCCGGAGGCGGCCGTCCGGATCGGCCGAGGCAGTGGTGCGGTCACGTGGGTCGTGGACCCCGACAACTAC
GACTGCCTGCTGCCGGTTGGCTGCGTCGGCGAGCTGCTCCTCGAAGGGCCGCTCCTCGGGCGCGGCTATCTGCAC
GAGCCGGCGAAAACGGCGGCCGCCTTCATCCACGACCCGGCATGGCTCCTGCGCGGTGCTCCGGGCCGGCCCGGA
CGCCACGGCCGCCTCTACCGGACCGGCGACCTCGTCCGGTACAACGAGGACGACGGCAGCCTGAGCTTCGTCGGC
CGCCGCGACGAGCAGGTCAAGATCCGCGGCCAGCGCGTCGAGCTGGGAGAGGTCGAGCACCGCGTTCACGAGTGC
CTGCCGCAGGCGAGGCAGGTTGTCGCCGAGGTCGTCGCGCCCGAGGGCTCGTCTGCCGCCCTGGCCGCCTTCCTC
GAGATGCCCGACGAGCGCTCCGCGGCCCGCCTCCTCCCGGCCGATGCCGACGTCGAGGACCGGCTGGGCAAGCTC
CTGCCGTCGTACATGATGCCGTCCATCTTCATGGCCTTGCCGGAGATGCCGAAAACGGCCTCGGGCAAGATAGAC
CGCAGGCGGCTGCGCGAGATGGGCGCGTCGCTCTCCGCCCAGCAGCTGGCCGACACGCGGACGACCTCGGGCACC
AAGAGGGCGCCCGTGTCCAAGACGGAGCAGCAGATGCAGGCCATCTGGGCCCAGGTGCTCAACATCGACCAGGCG
ACGGTCGGGCTGGACGACAGCTTCCTGCGCCTGGGAGGTGACTCCATCACGGCCATGCAGGTGGCGTCGGCGGCG
CGCTCGCGCCACATCCACGTCAGCGTCGCCGACATCCTGGGCAAGAAGACCATTTCCAAGCTTGTCGACGGCCTC
GAGCCGTCGTCCGTGGGCGAGCCGGTCAGCCGCGCGCTCGTCAGCCACGAGACGCTCGGCGGCCGGTCGATGCAG
CTGAGTCCGATCCAGAACCTCTACGTCCAGCTGCAGCCGGACCCGACCAAGTGCTGCTTCGACCAGAACTTCTTC
CTCAGCGTCAACGGCAGGATCACTCGTGACTCTCTCTCGGCCGCCCTCGAGACCATCGTCCGCAGGCACACCGTT
TTCTGTGCGCGTTTCACCAGGAACCAAGAGGGCATGTGGGAGCAGCGCATCACCCCCGACGCCTCGGCCTCGTTC
CGTCTGTTCGTCGACGAGTCCGGAGCGGACAAGACGGCCCATGCCATCGCCCAATGCCGCGACAGCCTGAACCTC
GAGGACGGGCCGCTGTTTGCTGCCCTGCTCTTCGACGACCCGGCCGCAACTCAGAGGCTATTCCTCACTATGCCA
CACTCCATAGTCGACCTGGTATCCTGGCGGGTCTTGCTCCGAGAGCTCGAGGCACTCTTGACATCGGGAACCCTC
ACTATGCCGCCGCCCCTGGGATTTCAGTCTTGGACCGCTCTTCAAGCCGAGTATGCTGCTGAGAAGCTGGATCCC
GCGGTCACGGCTCCGACCGAAGTCCGGCCACCTCTTCTCGAATACTGGGGAATGGATGTTAAGGAGAACCTTGAA
GGGGGCGCTGTCTTCAAGCGCTCCACCCTCGATGTGGCAACCAGCTCGGCGATCCTCAACGGCTGCAACGATGCC
CTGTCCACGCGCCCGCTCGAGCTCATGATAGCGGCACTGCTTCACGCCTTCGGCCTCGTCTTTTCCGACCGACCC
CTCCCCCCAATCTTCAGCGAGGGCCACGGTCGCGAGCCGTGGGATGACAGCATCGACATTTCTGCGACAGTTGGC
TGGTTCACGACGCTGTGGCCGGTGCAGATATCTTCCGGCAAGAACGCCAGCCTGATAGACACCATCCGCCGGACC
AAGGACTGCGTTCGAGCCTTGCCCCGAAAGGGCTGGTCGTGGTTTACGTCTCGTTTTGCGGATGCGGAGAAGGCG
GCCCGGTTTGCCTCGGGGTTCCCGGTCGAGATTCTCTTCAACTACCAAGGGCTTTACCAGCAGCTGGAGCGCAGT
GACGCTATCTTCGAGCAGATTGACCTGCCCCATGGATCTGCCCCGGCATCGAGCTCCGCGGTGCAGAGGTTCGCA
TTCTTCGAAATAGACGCCCGAGTCGAAAGGGGACGCATCGTCACATCAGTCGCTTACCATAAGGAGATGGGTCAT
CAGCAAAGAATCGCCGAATGGGTTGAAAAGTACGAGGAGACGCTTGTCCAGATGTCGAAAGAGCTCCCGGAAATG
CTTCCCAGCTGGACTCTCATGGAATTCCCTGCCGTCTTCTCCTCATACGAAGACATCGAGGAGTTCCAAAACGTG
TGGCTGGACCGACTCGGCATCCTTCGATTGGAGGACGTGGAAGACATCTTCCCCTGCTCGCCGATGCAAGAGGCC
ATATTGGTCAGCCAGGCCAAGGACTCGAATAACTATAGGCCATGGTCTCTCTACGAAATCAAAGTCAGAGGAGAG
GGCGCCCGGCTTGACATGGCCAGGCTCCAGCAGGCCTGGCAGGCTGTTGTGAGGCGGCATGGGCTCATGCGGGCC
ATTTTTGTCGACGGGCTCCCCGGGAGCGACGGGACCATGCATGTCGTCCTCCGCGACCCAAGCCCGAGCATATCT
GTCTTGGAAGAGGCCGGCGAGGCCATGGTGAGCAGGCTGCGGAACATGGATGACACGGGTGCATCCTATCCGAAA
CTTGGGTTGCAACATCATGTCACCATTTGCCAGCTGGACGCAGCAACGGCCTACATGCGGCTCGACATCAACCAC
ACCATCTCGGACGGCTTCTCGCAGGACCTGGTCCTGCGCGATCTTCAGGCGGCCTATCATGGCAGTCTTGGCCCG
GCTGGGACCTACCGCGACTTCGTCGCCTGTCTGGCAGAGCAGCCCAAGGACGCTGGGATCGAGTTCTGGTCCGGT
CGACTGGCCGGCGTTGAGCCATGCCTCTTCCCGGCTTTAGGAGGAGATGATATCGACCGCGCCGCTGCCGAAGCC
GTATCCGTCAAGGTTCCCAATCTCGACGCGGGCAAGATACGCGCCTTCTGCACGCGATGGACGCTGACGGCCGCA
ACACTGACGCAGACAGCGTGGGCGCTGGTGCTGAGCAAGTACACCGGGGCAACGATGCCGTGCTTTGGGAATCTA
TACTCAGGCCGAGACGTCCCGGTACACAAGGCTGAGACCATCTCCGGGCCCTTGATGGGCATGGCGCCCTGCCGA
GTACTGATTGACAGGTCGAAATCGGTGCTGGATACTCTGACAAAGGTCCAGGAGGATTTCCTCGGCAGCATGGCC
TTCCAGCACGTTCCTTTAGCCGCAATCCACAGGGCTCTTGGGCTTGGGACTTCCGCGCTTTTCAACAGCACATTG
TCCTTCCAGAGACCCGACGACGAGGGCCGAGTTGGCGCTGACAGCGTCGTCGTGAGAAACGTTTATGAGTGTGAC
CCGACCGAGTATGACGTGACTATCAGTGCTTTCGACAGAGGCTGCCTCTCCCAGGCGGTTTCTGAGATCATAAGC
GACCCCACACGCAGCCTCGGGGAGCTCGACCTGCTGGGGCCCTCCGACCTGGAGCAAATATGGGGATGGAACAAG
ACCCTTCCAGAACCGGCCGAGCAATGCGTCCACGAGATGGTCAAGGCCAAAGCCCAGGCTCACCCCGATGCCCCG
GCGATCTGTGCGTGGGACGGCAACCTGACATACGGCGAGCTGGACCTCCTAGCTTCGAGGTTGGCAAGACGGCTT
GTTGATTCCGGTGTCGAGCCGGGAATGATGCTGGCGTTATGCTTCGACAAGTCTATGTGGACGACGGTCGCGATA
CTCGGCGTAATGATGGCCGGGGGGTCCTTTGTGCTACTGGACCCATCACTTCCGGAGCAACGACTTCAGTTCGCT
TGCCAAAAGGCCAGAGCAAACTTGATTCTCTCGTCCACCGCCAACCAGACACTCAGCTTGCGGCTGTGCCAAAAA
GTGGTCGCCTTCGACTCCGACTTCTTCGACCAGCTCGACAAGACTGCTTCCTCGATAGATGACCTGCCAAGTGTC
GACCTAGACTCCATCATCTACCTTTGA
Gene >Hirsu2|5011
ATGGCTTCCGCAATCAAACAAAAACTGGAGTGGCGGCCGAGCTCGGCGGCGGACCATGACTGCGCACCGGCTCTT
CCGCCGCTGCCGCAGCAGCCGGCGGCCGACGAGGCAGTCGAGCTTGAATTCCCCTGGCCACAGGAACGGCCGACG
GACTCGAGGATGCTGCTGCTGGTCCGGGCGGCGTGGGCCGTCGTCGTCGGCCGCGAAACCAACTCCAAGGACGTC
GTGTTCGGCGGCGCCGAACCGGAGCGGAGCACCACCACATCCGCGACCGGCACCACGAACGGCGAGACGGCAGTC
CAGGAAACGGAGCCGGCCGCCGTTCATGTGCAGTGGACGAGCGACCAGAAGGTGACGGACTATCTCGAAGCAGTC
CAACAACTTTTCGAGCCGACTCAATGTCCGGGCGAAAGCCCTTCGAGCCGGCAATATCAAACATGTACTCTGCGC
ACCACATGTATGCTCCCGGTCCGGACGCAGCAGCAGCGTTCCGCGGCGGACGATCTCGGGGTTCCCCGCACGCAC
GCTGTCGTGCTCGAGGCGCAGCTCGGTCAAGAAATCAAAGTCACCGCTCGCTTCGACCAGAGACTCATGCAGGCC
CGGACCGGCCTCAGTCTGCTGCAGCGTCTAGCGTGCGTGGCGGGACAGCTAGCCGCCGCGGCGCCGGAGCAGGCG
GTGAAGGAGATGGAGACGGCCACGGGGCGTGACATCCAGCAGGTCTGGGCGTGGAACGGCGAGGTCCCGCCGGCG
GTGGACCGGTGTGTCCACGAGCTGGTCGAGGAGCAGGCCCGGGCCCGCCCCGACGCCGTCGCCGTCTGCGCCTGG
GACGGCGAGCTGACGTACGGCGAGCTGGACCGGCTGGCGGCGCGCGTCGCCGGCGACCTCGTCGGCCGCGGCGTC
GGGCCGGACTCGCTCGTGCCGCTCTGCTTCGAGAAGTCGAAGTGGACGACGGTCGCGATGCTGGCCGTGCTCAAG
GCCGGCGGCGGCTTCGTGCTGCTGGACGCCTCGCTGCCGGAGCAGCGCCTCCGGAACATCGTCGACCAGGCCGAC
GCCCGCCTCCTCCTCTCTTCCCCCTCCCGTCTGGCCCTGAGCTCGCGCCTGGCGCCTGTGGTTCTCCTCATCAGT
TCCGACTCCTTCGCCCATCCCGGCAACCAGCCGGATCGGCCCCTGCCACTCCCTTCCCCCTCGTCTGTCATGTAT
CTGGTCTTTACGTCTGGGAGCACGGGCAATCCCAAAGGCGTAATCGTAACCCACCGGAACTTCTCCACGGCCGTC
TTATACCAGGCACCGGACCTCGGCCTCTCCGCCGAGTCGAGGGTCTTCGACTTCGCGTCCTATGCGTTCGACGCC
TCCGTCAGCGATACCTTTCTCGTCCTCGCCACAGGGGGCTGCCTATGCGTGCCCAGCGACCAGGACCGGGCGGGC
AACATCTCGCTCAGCATAGCGTCTCTGAAGGCCAACGTCGTAGACGTGCCCCCGTCTGTCGCCCCCTTTCTCATT
CCCCAAGAGCTGCCGGACGTGCAAACTCTCATCTTTTCCGGCGAGGCCTTGCATACAAGGCACTTCCATCGATGG
TGGGACAGGGCGCGCATCATCAACGTCTACGGCCCTGCCGAATGCTCGCCCATCAGCCTCGTCAACGGCGAGGCG
TCGAGCCCGGAGGCGGCCGTCCGGATCGGCCGAGGCAGTGGTGCGGTCACGTGGGTCGTGGACCCCGACAACTAC
GACTGCCTGCTGCCGGTTGGCTGCGTCGGCGAGCTGCTCCTCGAAGGGCCGCTCCTCGGGCGCGGCTATCTGCAC
GAGCCGGCGAAAACGGCGGCCGCCTTCATCCACGACCCGGCATGGCTCCTGCGCGGTGCTCCGGGCCGGCCCGGA
CGCCACGGCCGCCTCTACCGGACCGGCGACCTCGTCCGGTACAACGAGGACGACGGCAGCCTGAGCTTCGTCGGC
CGCCGCGACGAGCAGGTCAAGATCCGCGGCCAGCGCGTCGAGCTGGGAGAGGTCGAGCACCGCGTTCACGAGTGC
CTGCCGCAGGCGAGGCAGGTTGTCGCCGAGGTCGTCGCGCCCGAGGGCTCGTCTGCCGCCCTGGCCGCCTTCCTC
GAGATGCCCGACGAGCGCTCCGCGGCCCGCCTCCTCCCGGCCGATGCCGACGTCGAGGACCGGCTGGGCAAGCTC
CTGCCGTCGTACATGATGCCGTCCATCTTCATGGCCTTGCCGGAGATGCCGAAAACGGCCTCGGGCAAGATAGAC
CGCAGGCGGCTGCGCGAGATGGGCGCGTCGCTCTCCGCCCAGCAGCTGGCCGACACGCGGACGACCTCGGGCACC
AAGAGGGCGCCCGTGTCCAAGACGGAGCAGCAGATGCAGGCCATCTGGGCCCAGGTGCTCAACATCGACCAGGCG
ACGGTCGGGCTGGACGACAGCTTCCTGCGCCTGGGAGGTGACTCCATCACGGCCATGCAGGTGGCGTCGGCGGCG
CGCTCGCGCCACATCCACGTCAGCGTCGCCGACATCCTGGGCAAGAAGACCATTTCCAAGCTTGTCGACGGCCTC
GAGCCGTCGTCCGTGGGCGAGCCGGTCAGCCGCGCGCTCGTCAGCCACGAGACGCTCGGCGGCCGGTCGATGCAG
CTGAGTCCGATCCAGAACCTCTACGTCCAGCTGCAGCCGGACCCGACCAAGTGCTGCTTCGACCAGAACTTCTTC
CTCAGCGTCAACGGCAGGATCACTCGTGACTCTCTCTCGGCCGCCCTCGAGACCATCGTCCGCAGGCACACCGTT
TTCTGTGCGCGTTTCACCAGGAACCAAGAGGGCATGTGGGAGCAGCGCATCACCCCCGACGCCTCGGCCTCGTTC
CGTCTGTTCGTCGACGAGTCCGGAGCGGACAAGACGGCCCATGCCATCGCCCAATGCCGCGACAGCCTGAACCTC
GAGGACGGGCCGCTGTTTGCTGCCCTGCTCTTCGACGACCCGGCCGCAACTCAGAGGCTATTCCTCACTATGCCA
CACTCCATAGTCGACCTGGTATCCTGGCGGGTCTTGCTCCGAGAGCTCGAGGCACTCTTGACATCGGGAACCCTC
ACTATGCCGCCGCCCCTGGGATTTCAGTCTTGGACCGCTCTTCAAGCCGAGTATGCTGCTGAGAAGCTGGATCCC
GCGGTCACGGCTCCGACCGAAGTCCGGCCACCTCTTCTCGAATACTGGGGAATGGATGTTAAGGAGAACCTTGAA
GGGGGCGCTGTCTTCAAGCGCTCCACCCTCGATGTGGCAACCAGCTCGGCGATCCTCAACGGCTGCAACGATGCC
CTGTCCACGCGCCCGCTCGAGCTCATGATAGCGGCACTGCTTCACGCCTTCGGCCTCGTCTTTTCCGACCGACCC
CTCCCCCCAATCTTCAGCGAGGGCCACGGTCGCGAGCCGTGGGATGACAGCATCGACATTTCTGCGACAGTTGGC
TGGTTCACGACGCTGTGGCCGGTGCAGATATCTTCCGGCAAGAACGCCAGCCTGATAGACACCATCCGCCGGACC
AAGGACTGCGTTCGAGCCTTGCCCCGAAAGGGCTGGTCGTGGTTTACGTCTCGTTTTGCGGATGCGGAGAAGGCG
GCCCGGTTTGCCTCGGGGTTCCCGGTCGAGATTCTCTTCAACTACCAAGGGCTTTACCAGCAGCTGGAGCGCAGT
GACGCTATCTTCGAGCAGATTGACCTGCCCCATGGATCTGCCCCGGCATCGAGCTCCGCGGTGCAGAGGTTCGCA
TTCTTCGAAATAGACGCCCGAGTCGAAAGGGGACGCATCGTCACATCAGTCGCTTACCATAAGGAGATGGGTCAT
CAGCAAAGAATCGCCGAATGGGTTGAAAAGTACGAGGAGACGCTTGTCCAGATGTCGAAAGAGCTCCCGGAAATG
CTTCCCAGCTGGACTCTCATGGAATTCCCTGCCGTCTTCTCCTCATACGAAGACATCGAGGAGTTCCAAAACGTG
TGGCTGGACCGACTCGGCATCCTTCGATTGGAGGACGTGGAAGACATCTTCCCCTGCTCGCCGATGCAAGAGGCC
ATATTGGTCAGCCAGGCCAAGGACTCGAATAACTATAGGCCATGGTCTCTCTACGAAATCAAAGTCAGAGGAGAG
GGCGCCCGGCTTGACATGGCCAGGCTCCAGCAGGCCTGGCAGGCTGTTGTGAGGCGGCATGGGCTCATGCGGGCC
ATTTTTGTCGACGGGCTCCCCGGGAGCGACGGGACCATGCATGTCGTCCTCCGCGACCCAAGCCCGAGCATATCT
GTCTTGGAAGAGGCCGGCGAGGCCATGGTGAGCAGGCTGCGGAACATGGATGACACGGGTGCATCCTATCCGAAA
CTTGGGTTGCAACATCATGTCACCATTTGCCAGCTGGACGCAGCAACGGCCTACATGCGGCTCGACATCAACCAC
ACCATCTCGGACGGCTTCTCGCAGGACCTGGTCCTGCGCGATCTTCAGGCGGCCTATCATGGCAGTCTTGGCCCG
GCTGGGACCTACCGCGACTTCGTCGCCTGTCTGGCAGAGCAGCCCAAGGACGCTGGGATCGAGTTCTGGTCCGGT
CGACTGGCCGGCGTTGAGCCATGCCTCTTCCCGGCTTTAGGAGGAGATGATATCGACCGCGCCGCTGCCGAAGCC
GTATCCGTCAAGGTTCCCAATCTCGACGCGGGCAAGATACGCGCCTTCTGCACGCGATGGACGCTGACGGCCGCA
ACACTGACGCAGACAGCGTGGGCGCTGGTGCTGAGCAAGTACACCGGGGCAACGATGCCGTGCTTTGGGAATCTA
TACTCAGGCCGAGACGTCCCGGTACACAAGGCTGAGACCATCTCCGGGCCCTTGATGGGCATGGCGCCCTGCCGA
GTACTGATTGACAGGTCGAAATCGGTGCTGGATACTCTGACAAAGGTCCAGGAGGATTTCCTCGGCAGCATGGCC
TTCCAGCACGTTCCTTTAGCCGCAATCCACAGGGCTCTTGGGCTTGGGACTTCCGCGCTTTTCAACAGCACATTG
TCCTTCCAGAGACCCGACGACGAGGGCCGAGTTGGCGCTGACAGCGTCGTCGTGAGAAACGTTTATGAGTGTGAC
CCGACCGAGGTACGATAGGCCAGCTCTCCGGAACTGACGGCTTCGAAAGAAATACTGACTCTCCCCGAACAGTAT
GACGTGACTATCAGTGCTTTCGACAGAGGTACGGACATGCGGATACAGGTAGACGCCCGCCCCGGATATATGACC
CTCGTAGACGCGACCCGCCTGGCAGGCTGCCTCTCCCAGGCGGTTTCTGAGATCATAAGCGACCCCACACGCAGC
CTCGGGGAGCTCGACCTGCTGGGGCCCTCCGACCTGGAGCAAATATGGGGATGGAACAAGACCCTTCCAGAACCG
GCCGAGCAATGCGTCCACGAGATGGTCAAGGCCAAAGCCCAGGCTCACCCCGATGCCCCGGCGATCTGTGCGTGG
GACGGCAACCTGACATACGGCGAGCTGGACCTCCTAGCTTCGAGGTTGGCAAGACGGCTTGTTGATTCCGGTGTC
GAGCCGGGAATGATGCTGGCGTTATGCTTCGACAAGTCTATGTGGACGACGGTCGCGATACTCGGCGTAATGATG
GCCGGGGGGTCCTTTGTGCTACTGGACCCATCACTTCCGGAGCAACGACTTCAGTTCGCTTGCCAAAAGGCCAGA
GCAAACTTGATTCTCTCGTCCACCGCCAACCAGACACTCAGCTTGCGGCTGTGCCAAAAAGTGGTCGCCTTCGAC
TCCGACTTCTTCGACCAGCTCGACAAGACTGCTTCCTCGATAGATGACCTGCCAAGTGTCGACCTAGACTCCATC
ATCTACGTGTGTTTCACCTCAGGGTCAACGGGGGTGCCGAAGGCAGTGACCATCACGCATCGAAACTCCGCCTCG
GCTGTCAGCCATCAGATGCAGGGTTTTGGCTACACAGCTGGATCCCGGCTCTACGATTTCTCGTCGTACAGCTTT
GA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail