Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5005
Gene name
LocationContig_2506:1482..1953
Strand-
Gene length (bp)471
Transcript length (bp)471
Coding sequence length (bp)471
Protein length (aa) 157

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02178 AT_hook AT hook motif 4.2E-02 14 25
PF02178 AT_hook AT hook motif 7.4E-02 77 87
PF02178 AT_hook AT hook motif 3.7E-02 112 123
PF02178 AT_hook AT hook motif 9.0E-02 146 155

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5005
MEQRPASPVPFSEPRKRGRPPKASKQFSDSVQSNVVQDDVMQADTIQSEVVQADAIQSDAVQSDVVQSDVVQSDI
VRRRGRPPKASKQLSEAVSEAVQSPQAPKASEPASEPRKRGRPPKAANPLQAAEKKGPPSAGPKPSGVEKKRGRG
RPRKTV*
Coding >Hirsu2|5005
ATGGAACAGCGACCGGCATCGCCGGTGCCGTTCAGCGAACCCCGCAAGAGGGGCCGACCGCCCAAGGCGTCAAAG
CAGTTCAGCGACTCAGTGCAGAGCAACGTGGTCCAGGACGACGTGATGCAGGCCGACACGATCCAGAGTGAAGTG
GTCCAGGCCGACGCGATCCAGAGCGACGCGGTCCAGAGCGACGTGGTCCAGAGCGACGTGGTCCAGAGCGACATA
GTCCGGAGGAGGGGGCGGCCACCCAAGGCGTCGAAGCAGTTGAGCGAGGCAGTGAGCGAGGCAGTGCAGAGCCCA
CAGGCGCCCAAGGCGTCGGAGCCAGCGAGCGAACCACGGAAGAGGGGCCGGCCGCCAAAGGCCGCGAACCCGCTC
CAGGCGGCGGAGAAGAAGGGGCCGCCGTCGGCCGGTCCCAAACCGTCAGGGGTCGAGAAGAAACGGGGAAGGGGG
AGGCCGCGGAAAACGGTGTGA
Transcript >Hirsu2|5005
ATGGAACAGCGACCGGCATCGCCGGTGCCGTTCAGCGAACCCCGCAAGAGGGGCCGACCGCCCAAGGCGTCAAAG
CAGTTCAGCGACTCAGTGCAGAGCAACGTGGTCCAGGACGACGTGATGCAGGCCGACACGATCCAGAGTGAAGTG
GTCCAGGCCGACGCGATCCAGAGCGACGCGGTCCAGAGCGACGTGGTCCAGAGCGACGTGGTCCAGAGCGACATA
GTCCGGAGGAGGGGGCGGCCACCCAAGGCGTCGAAGCAGTTGAGCGAGGCAGTGAGCGAGGCAGTGCAGAGCCCA
CAGGCGCCCAAGGCGTCGGAGCCAGCGAGCGAACCACGGAAGAGGGGCCGGCCGCCAAAGGCCGCGAACCCGCTC
CAGGCGGCGGAGAAGAAGGGGCCGCCGTCGGCCGGTCCCAAACCGTCAGGGGTCGAGAAGAAACGGGGAAGGGGG
AGGCCGCGGAAAACGGTGTGA
Gene >Hirsu2|5005
ATGGAACAGCGACCGGCATCGCCGGTGCCGTTCAGCGAACCCCGCAAGAGGGGCCGACCGCCCAAGGCGTCAAAG
CAGTTCAGCGACTCAGTGCAGAGCAACGTGGTCCAGGACGACGTGATGCAGGCCGACACGATCCAGAGTGAAGTG
GTCCAGGCCGACGCGATCCAGAGCGACGCGGTCCAGAGCGACGTGGTCCAGAGCGACGTGGTCCAGAGCGACATA
GTCCGGAGGAGGGGGCGGCCACCCAAGGCGTCGAAGCAGTTGAGCGAGGCAGTGAGCGAGGCAGTGCAGAGCCCA
CAGGCGCCCAAGGCGTCGGAGCCAGCGAGCGAACCACGGAAGAGGGGCCGGCCGCCAAAGGCCGCGAACCCGCTC
CAGGCGGCGGAGAAGAAGGGGCCGCCGTCGGCCGGTCCCAAACCGTCAGGGGTCGAGAAGAAACGGGGAAGGGGG
AGGCCGCGGAAAACGGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail