Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5004
Gene name
LocationContig_2504:797..2174
Strand+
Gene length (bp)1377
Transcript length (bp)1290
Coding sequence length (bp)1290
Protein length (aa) 430

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03151 TPT Triose-phosphate Transporter family 5.6E-57 19 342

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94695|YG1B_SCHPO Putative transporter C83.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC83.11 PE=1 SV=2 20 382 2.0E-88
sp|P22215|SLY41_YEAST Uncharacterized transporter SLY41 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLY41 PE=1 SV=2 16 355 6.0E-49
sp|Q9VR50|S35E1_DROME Solute carrier family 35 member E1 homolog OS=Drosophila melanogaster GN=CG14621 PE=2 SV=1 20 373 5.0E-36
sp|Q84QU8|PPT2_ORYSJ Phosphoenolpyruvate/phosphate translocator 2, chloroplastic OS=Oryza sativa subsp. japonica GN=PPT2 PE=2 SV=1 26 344 1.0E-33
sp|Q5VQL3|PPT3_ORYSJ Phosphoenolpyruvate/phosphate translocator 3, chloroplastic OS=Oryza sativa subsp. japonica GN=PPT3 PE=2 SV=1 19 352 1.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94695|YG1B_SCHPO Putative transporter C83.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC83.11 PE=1 SV=2 20 382 2.0E-88
sp|P22215|SLY41_YEAST Uncharacterized transporter SLY41 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLY41 PE=1 SV=2 16 355 6.0E-49
sp|Q9VR50|S35E1_DROME Solute carrier family 35 member E1 homolog OS=Drosophila melanogaster GN=CG14621 PE=2 SV=1 20 373 5.0E-36
sp|Q84QU8|PPT2_ORYSJ Phosphoenolpyruvate/phosphate translocator 2, chloroplastic OS=Oryza sativa subsp. japonica GN=PPT2 PE=2 SV=1 26 344 1.0E-33
sp|Q5VQL3|PPT3_ORYSJ Phosphoenolpyruvate/phosphate translocator 3, chloroplastic OS=Oryza sativa subsp. japonica GN=PPT3 PE=2 SV=1 19 352 1.0E-32
sp|P0C6B1|S35E1_RAT Solute carrier family 35 member E1 OS=Rattus norvegicus GN=Slc35e1 PE=3 SV=1 19 354 2.0E-32
sp|Q96K37|S35E1_HUMAN Solute carrier family 35 member E1 OS=Homo sapiens GN=SLC35E1 PE=1 SV=2 19 367 2.0E-31
sp|Q8CD26|S35E1_MOUSE Solute carrier family 35 member E1 OS=Mus musculus GN=Slc35e1 PE=1 SV=2 19 354 2.0E-31
sp|Q69VR7|PPT1_ORYSJ Phosphoenolpyruvate/phosphate translocator 1, chloroplastic OS=Oryza sativa subsp. japonica GN=PPT1 PE=2 SV=1 26 344 4.0E-30
sp|P39542|YJT3_YEAST Uncharacterized transporter YJL193W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL193W PE=1 SV=1 6 356 7.0E-30
sp|Q8H0T6|PPT2_ARATH Phosphoenolpyruvate/phosphate translocator 2, chloroplastic OS=Arabidopsis thaliana GN=PPT2 PE=2 SV=1 26 347 2.0E-26
sp|Q8RXN3|PPT1_ARATH Phosphoenolpyruvate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana GN=PPT1 PE=1 SV=1 19 344 3.0E-26
sp|Q9LF61|XPT_ARATH Xylulose 5-phosphate/phosphate translocator, chloroplastic OS=Arabidopsis thaliana GN=XPT PE=1 SV=1 26 350 1.0E-25
sp|P52178|TPT2_BRAOB Triose phosphate/phosphate translocator, non-green plastid, chloroplastic OS=Brassica oleracea var. botrytis GN=NGTPT PE=2 SV=1 19 344 4.0E-25
sp|Q94B38|GPT2_ARATH Glucose-6-phosphate/phosphate translocator 2, chloroplastic OS=Arabidopsis thaliana GN=GPT2 PE=2 SV=2 27 347 5.0E-24
sp|P52177|TPT1_BRAOB Triose phosphate/phosphate translocator, chloroplastic OS=Brassica oleracea var. botrytis GN=TPT PE=2 SV=1 22 354 4.0E-23
sp|Q9M5A9|GPT1_ARATH Glucose-6-phosphate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana GN=GPT1 PE=2 SV=1 27 345 4.0E-22
sp|Q9FTT3|TPT_ORYSJ Triose phosphate/phosphate translocator TPT, chloroplastic OS=Oryza sativa subsp. japonica GN=TPT PE=2 SV=1 25 356 9.0E-22
sp|P11869|TPT_SPIOL Triose phosphate/phosphate translocator, chloroplastic OS=Spinacia oleracea PE=1 SV=1 25 354 2.0E-21
sp|P29463|TPT_SOLTU Triose phosphate/phosphate translocator, chloroplastic OS=Solanum tuberosum GN=TPT PE=2 SV=1 25 356 1.0E-20
sp|Q9ZSR7|TPT_ARATH Triose phosphate/phosphate translocator TPT, chloroplastic OS=Arabidopsis thaliana GN=TPT PE=1 SV=1 25 354 2.0E-20
sp|P21727|TPT_PEA Triose phosphate/phosphate translocator, chloroplastic OS=Pisum sativum PE=1 SV=1 27 354 2.0E-20
sp|P49132|TPT_FLATR Triose phosphate/phosphate translocator, chloroplastic OS=Flaveria trinervia GN=TPT PE=2 SV=1 25 354 5.0E-20
sp|P49131|TPT_FLAPR Triose phosphate/phosphate translocator, chloroplastic OS=Flaveria pringlei GN=TPT PE=2 SV=1 25 355 7.0E-20
sp|P49133|TPT_MAIZE Triose phosphate/phosphate translocator, chloroplastic OS=Zea mays GN=TPT PE=1 SV=1 25 356 1.0E-19
sp|Q8C811|S35E2_MOUSE Solute carrier family 35 member E2 OS=Mus musculus GN=Slc35e2 PE=2 SV=1 17 374 3.0E-18
sp|P0CK96|S352B_HUMAN Solute carrier family 35 member E2B OS=Homo sapiens GN=SLC35E2B PE=2 SV=1 17 374 3.0E-15
sp|Q9SS40|PT310_ARATH Probable sugar phosphate/phosphate translocator At3g10290 OS=Arabidopsis thaliana GN=At3g10290 PE=3 SV=1 23 356 6.0E-12
sp|Q6DBP3|PT505_ARATH Probable sugar phosphate/phosphate translocator At5g05820 OS=Arabidopsis thaliana GN=At5g05820 PE=2 SV=1 119 350 1.0E-11
sp|Q9FYE5|PT504_ARATH Probable sugar phosphate/phosphate translocator At5g04160 OS=Arabidopsis thaliana GN=At5g04160 PE=2 SV=1 23 356 1.0E-10
sp|Q9SFE9|GONS5_ARATH GDP-mannose transporter GONST5 OS=Arabidopsis thaliana GN=GONST5 PE=2 SV=1 110 373 3.0E-10
sp|Q5XF09|PT311_ARATH Probable sugar phosphate/phosphate translocator At3g11320 OS=Arabidopsis thaliana GN=At3g11320 PE=2 SV=1 119 350 3.0E-10
sp|Q8H184|PT106_ARATH Probable sugar phosphate/phosphate translocator At1g06470 OS=Arabidopsis thaliana GN=At1g06470 PE=2 SV=1 11 364 1.0E-08
sp|Q9LDH3|PT112_ARATH Probable sugar phosphate/phosphate translocator At1g12500 OS=Arabidopsis thaliana GN=At1g12500 PE=1 SV=1 91 360 2.0E-08
sp|Q9C521|UGAL1_ARATH UDP-galactose transporter 1 OS=Arabidopsis thaliana GN=UDP-GALT1 PE=2 SV=1 110 378 5.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22
2 51 73 22
3 94 111 17
4 121 143 22
5 150 172 22
6 177 196 19
7 223 245 22
8 281 303 22
9 310 332 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5004
MSQNAHEIAGALRAPVSPRLVVLCLLWYTSSALTNTSSKSILIAFDKPATLTVVQFAFVSSLCIALAWLASIFPA
LRTQMAVLRHPIRRPSKDVIMNTLPLAAFQIGGHLLSSTATAKIPVSLVHTIKGLSPLFTVLAYRIFYDIRYPQA
TYLSLAPLTIGVMLACSGKATYGGHLLGVLQALLATLIFVTQNIVSKKIFNEAAKAEAEAPGVQSKKLDKLNLLC
YSSGMAFVVTLPIWFWAEGIDILGDFLHDGAIDLSNNPIAMDHGRLALEFVFNGVFHFSQNMLAFVLLSIVSPVT
YSVASLVKRVFVIVIAIMWFKSPTTPIQAVGIALTLFGLYLYDRSSESNKADRRARLIAQSRSGTPLLPVDEKQP
AVGYRSPSLLTHLSAHPYTEGHFGLAAAADDAKKADKVGRSRSGLSSTSWMLRQ*
Coding >Hirsu2|5004
ATGAGCCAGAACGCTCACGAAATCGCGGGTGCGCTGAGAGCCCCTGTGTCACCAAGACTGGTCGTCCTGTGCTTA
CTCTGGTACACATCCTCCGCGCTGACCAACACATCCTCTAAATCTATCCTCATCGCCTTCGATAAGCCGGCGACT
CTGACCGTCGTTCAATTTGCATTCGTTTCCTCGCTCTGCATTGCCCTCGCCTGGCTGGCCAGCATCTTTCCTGCT
CTACGAACTCAAATGGCTGTCTTGAGGCATCCTATCCGCCGGCCGAGCAAGGACGTCATCATGAACACTCTTCCT
CTTGCCGCCTTCCAAATCGGCGGCCATCTGCTGAGCTCGACTGCCACAGCCAAGATTCCAGTCTCTCTGGTCCAC
ACCATCAAGGGTCTGTCACCCTTGTTCACCGTGCTGGCCTACAGGATCTTCTACGACATTCGATACCCCCAGGCC
ACCTACCTTTCGCTCGCACCCCTGACTATCGGCGTCATGCTCGCCTGCTCGGGAAAGGCGACGTATGGCGGGCAC
TTGCTGGGGGTCTTGCAGGCACTGTTGGCGACGCTCATCTTCGTCACGCAAAACATTGTCTCCAAGAAGATCTTC
AATGAGGCAGCCAAGGCCGAGGCCGAAGCTCCTGGCGTGCAGTCCAAGAAGCTAGACAAGCTCAACCTACTGTGC
TATTCTTCTGGCATGGCATTCGTTGTGACCCTACCCATCTGGTTTTGGGCCGAGGGCATTGACATTCTGGGAGAC
TTCCTGCACGACGGCGCGATAGATCTCAGTAACAACCCTATTGCAATGGACCACGGTCGCCTGGCCCTCGAATTC
GTCTTCAATGGCGTCTTTCACTTCAGCCAAAACATGTTGGCATTTGTACTGCTGTCGATCGTCTCCCCCGTCACG
TACTCAGTCGCGAGCCTGGTCAAGAGGGTCTTTGTCATCGTTATAGCCATCATGTGGTTCAAGAGTCCCACAACG
CCCATCCAGGCGGTGGGCATCGCGCTGACATTGTTCGGCTTATACCTTTACGATCGGTCTAGCGAGAGCAACAAG
GCCGATCGCAGGGCGCGCCTGATAGCACAATCTCGGAGCGGGACCCCGCTCCTCCCTGTCGACGAGAAACAGCCA
GCGGTCGGCTATCGCAGCCCCAGTCTTTTGACCCATTTGAGCGCCCACCCTTACACAGAAGGCCACTTCGGCTTG
GCCGCCGCCGCCGACGACGCTAAGAAAGCTGACAAGGTCGGCCGTAGCCGTTCTGGGCTTAGCAGCACAAGTTGG
ATGTTACGCCAATGA
Transcript >Hirsu2|5004
ATGAGCCAGAACGCTCACGAAATCGCGGGTGCGCTGAGAGCCCCTGTGTCACCAAGACTGGTCGTCCTGTGCTTA
CTCTGGTACACATCCTCCGCGCTGACCAACACATCCTCTAAATCTATCCTCATCGCCTTCGATAAGCCGGCGACT
CTGACCGTCGTTCAATTTGCATTCGTTTCCTCGCTCTGCATTGCCCTCGCCTGGCTGGCCAGCATCTTTCCTGCT
CTACGAACTCAAATGGCTGTCTTGAGGCATCCTATCCGCCGGCCGAGCAAGGACGTCATCATGAACACTCTTCCT
CTTGCCGCCTTCCAAATCGGCGGCCATCTGCTGAGCTCGACTGCCACAGCCAAGATTCCAGTCTCTCTGGTCCAC
ACCATCAAGGGTCTGTCACCCTTGTTCACCGTGCTGGCCTACAGGATCTTCTACGACATTCGATACCCCCAGGCC
ACCTACCTTTCGCTCGCACCCCTGACTATCGGCGTCATGCTCGCCTGCTCGGGAAAGGCGACGTATGGCGGGCAC
TTGCTGGGGGTCTTGCAGGCACTGTTGGCGACGCTCATCTTCGTCACGCAAAACATTGTCTCCAAGAAGATCTTC
AATGAGGCAGCCAAGGCCGAGGCCGAAGCTCCTGGCGTGCAGTCCAAGAAGCTAGACAAGCTCAACCTACTGTGC
TATTCTTCTGGCATGGCATTCGTTGTGACCCTACCCATCTGGTTTTGGGCCGAGGGCATTGACATTCTGGGAGAC
TTCCTGCACGACGGCGCGATAGATCTCAGTAACAACCCTATTGCAATGGACCACGGTCGCCTGGCCCTCGAATTC
GTCTTCAATGGCGTCTTTCACTTCAGCCAAAACATGTTGGCATTTGTACTGCTGTCGATCGTCTCCCCCGTCACG
TACTCAGTCGCGAGCCTGGTCAAGAGGGTCTTTGTCATCGTTATAGCCATCATGTGGTTCAAGAGTCCCACAACG
CCCATCCAGGCGGTGGGCATCGCGCTGACATTGTTCGGCTTATACCTTTACGATCGGTCTAGCGAGAGCAACAAG
GCCGATCGCAGGGCGCGCCTGATAGCACAATCTCGGAGCGGGACCCCGCTCCTCCCTGTCGACGAGAAACAGCCA
GCGGTCGGCTATCGCAGCCCCAGTCTTTTGACCCATTTGAGCGCCCACCCTTACACAGAAGGCCACTTCGGCTTG
GCCGCCGCCGCCGACGACGCTAAGAAAGCTGACAAGGTCGGCCGTAGCCGTTCTGGGCTTAGCAGCACAAGTTGG
ATGTTACGCCAATGA
Gene >Hirsu2|5004
ATGAGCCAGAACGCTCACGAAATCGCGGGTGCGCTGAGAGCCCCTGTGTCACCAAGACTGGTCGTACGTTACATC
ACCTTCAACTCGTCGTTGAATCGCTTGGATTTTGGCCACTCTTTCGTCGGTAGCTAACCGATCGTCGGTCGGCAG
GTCCTGTGCTTACTCTGGTACACATCCTCCGCGCTGACCAACACATCCTCTAAATCTATCCTCATCGCCTTCGAT
AAGCCGGCGACTCTGACCGTCGTTCAATTTGCATTCGTTTCCTCGCTCTGCATTGCCCTCGCCTGGCTGGCCAGC
ATCTTTCCTGCTCTACGAACTCAAATGGCTGTCTTGAGGCATCCTATCCGCCGGCCGAGCAAGGACGTCATCATG
AACACTCTTCCTCTTGCCGCCTTCCAAATCGGCGGCCATCTGCTGAGCTCGACTGCCACAGCCAAGATTCCAGTC
TCTCTGGTCCACACCATCAAGGGTCTGTCACCCTTGTTCACCGTGCTGGCCTACAGGATCTTCTACGACATTCGA
TACCCCCAGGCCACCTACCTTTCGCTCGCACCCCTGACTATCGGCGTCATGCTCGCCTGCTCGGGAAAGGCGACG
TATGGCGGGCACTTGCTGGGGGTCTTGCAGGCACTGTTGGCGACGCTCATCTTCGTCACGCAAAACATTGTCTCC
AAGAAGATCTTCAATGAGGCAGCCAAGGCCGAGGCCGAAGCTCCTGGCGTGCAGTCCAAGAAGCTAGACAAGCTC
AACCTACTGTGCTATTCTTCTGGCATGGCATTCGTTGTGACCCTACCCATCTGGTTTTGGGCCGAGGGCATTGAC
ATTCTGGGAGACTTCCTGCACGACGGCGCGATAGATCTCAGTAACAACCCTATTGCAATGGACCACGGTCGCCTG
GCCCTCGAATTCGTCTTCAATGGCGTCTTTCACTTCAGCCAAAACATGTTGGCATTTGTACTGCTGTCGATCGTC
TCCCCCGTCACGTACTCAGTCGCGAGCCTGGTCAAGAGGGTCTTTGTCATCGTTATAGCCATCATGTGGTTCAAG
AGTCCCACAACGCCCATCCAGGCGGTGGGCATCGCGCTGACATTGTTCGGCTTATACCTTTACGATCGGTCTAGC
GAGAGCAACAAGGCCGATCGCAGGGCGCGCCTGATAGCACAATCTCGGAGCGGGACCCCGCTCCTCCCTGTCGAC
GAGAAACAGCCAGCGGTCGGCTATCGCAGCCCCAGTCTTTTGACCCATTTGAGCGCCCACCCTTACACAGAAGGC
CACTTCGGCTTGGCCGCCGCCGCCGACGACGCTAAGAAAGCTGACAAGGTCGGCCGTAGCCGTTCTGGGCTTAGC
AGCACAAGTTGGATGTTACGCCAATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail