Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5002
Gene name
LocationContig_2503:850..1269
Strand+
Gene length (bp)419
Transcript length (bp)291
Coding sequence length (bp)291
Protein length (aa) 97

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08122 NDUF_B12 NADH-ubiquinone oxidoreductase B12 subunit family 6.6E-24 35 87

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0022900 electron transport chain Yes
GO:0005739 mitochondrion Yes
GO:0005747 mitochondrial respiratory chain complex I Yes
GO:0044446 intracellular organelle part No
GO:0043227 membrane-bounded organelle No
GO:0009987 cellular process No
GO:1990204 oxidoreductase complex No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0006091 generation of precursor metabolites and energy No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0043231 intracellular membrane-bounded organelle No
GO:0044425 membrane part No
GO:0044455 mitochondrial membrane part No
GO:0098800 inner mitochondrial membrane protein complex No
GO:0043229 intracellular organelle No
GO:0045271 respiratory chain complex I No
GO:0044237 cellular metabolic process No
GO:1902494 catalytic complex No
GO:0098803 respiratory chain complex No
GO:0098798 mitochondrial protein complex No
GO:0030964 NADH dehydrogenase complex No
GO:0055114 oxidation-reduction process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044429 mitochondrial part No
GO:0043226 organelle No
GO:0044422 organelle part No
GO:0098796 membrane protein complex No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 58 80 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5002
MLPTKILRAARGPKPNITGFSMRALKEATGQPRYDPWERAEAWRYTGTFSRWNRFNSALPGLGTATVAFAGYCLY
EHFFLNDDHHHDKDHADGDHH*
Coding >Hirsu2|5002
ATGCTGCCCACCAAGATCCTGCGCGCCGCCCGCGGGCCCAAGCCCAACATCACCGGCTTCAGCATGCGCGCCCTC
AAGGAGGCCACCGGCCAGCCGCGATACGACCCGTGGGAGCGCGCAGAGGCGTGGAGGTACACCGGCACCTTCTCG
CGCTGGAACCGCTTCAACTCGGCCCTCCCGGGCCTGGGCACCGCCACCGTCGCCTTCGCCGGCTACTGCCTCTAC
GAGCACTTCTTCCTCAACGACGACCATCACCACGACAAGGACCACGCCGACGGGGACCATCACTGA
Transcript >Hirsu2|5002
ATGCTGCCCACCAAGATCCTGCGCGCCGCCCGCGGGCCCAAGCCCAACATCACCGGCTTCAGCATGCGCGCCCTC
AAGGAGGCCACCGGCCAGCCGCGATACGACCCGTGGGAGCGCGCAGAGGCGTGGAGGTACACCGGCACCTTCTCG
CGCTGGAACCGCTTCAACTCGGCCCTCCCGGGCCTGGGCACCGCCACCGTCGCCTTCGCCGGCTACTGCCTCTAC
GAGCACTTCTTCCTCAACGACGACCATCACCACGACAAGGACCACGCCGACGGGGACCATCACTGA
Gene >Hirsu2|5002
ATGCTGCCCACCAAGTATTGCCCAGCCCGCTCCTCCCAGCGGACGAGGTCGACGCTGACGAGACGGGGCCAGGAT
CCTGCGCGCCGCCCGCGGGCCCAAGCCCAACATCACCGGCTTCAGCATGCGCGCCCTCAAGGAGGCCACCGGCCA
GCCGCGATACGACCCGTGGGAGCGCGCGTCCGTCCCTCTACTCCTTACCTCTCCTCAGCTCCCCGGCAGAGGGCG
GATGCTGACTGGCGGCCCGCAGAGAGGCGTGGAGGTACACCGGCACCTTCTCGCGCTGGAACCGCTTCAACTCGG
CCCTCCCGGGCCTGGGCACCGCCACCGTCGCCTTCGCCGGCTACTGCCTCTACGAGCACTTCTTCCTCAACGACG
ACCATCACCACGACAAGGACCACGCCGACGGGGACCATCACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail