Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4993
Gene name
LocationContig_250:18061..19255
Strand+
Gene length (bp)1194
Transcript length (bp)1116
Coding sequence length (bp)1116
Protein length (aa) 372

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01156 IU_nuc_hydro Inosine-uridine preferring nucleoside hydrolase 2.5E-41 23 350

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HGL1|YHLB_SCHPO Uncharacterized protein C800.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC800.11 PE=3 SV=1 2 357 2.0E-45
sp|Q9SJM7|URH1_ARATH Uridine nucleosidase 1 OS=Arabidopsis thaliana GN=URH1 PE=1 SV=2 11 282 8.0E-15
sp|Q8LAC4|URH2_ARATH Probable uridine nucleosidase 2 OS=Arabidopsis thaliana GN=URH2 PE=2 SV=1 18 279 6.0E-14
sp|Q6ZJ05|URH1_ORYSJ Probable uridine nucleosidase 1 OS=Oryza sativa subsp. japonica GN=URH1 PE=2 SV=1 19 282 2.0E-12
sp|Q652Q8|URH2_ORYSJ Probable uridine nucleosidase 2 OS=Oryza sativa subsp. japonica GN=URH2 PE=2 SV=1 12 274 4.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HGL1|YHLB_SCHPO Uncharacterized protein C800.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC800.11 PE=3 SV=1 2 357 2.0E-45
sp|Q9SJM7|URH1_ARATH Uridine nucleosidase 1 OS=Arabidopsis thaliana GN=URH1 PE=1 SV=2 11 282 8.0E-15
sp|Q8LAC4|URH2_ARATH Probable uridine nucleosidase 2 OS=Arabidopsis thaliana GN=URH2 PE=2 SV=1 18 279 6.0E-14
sp|Q6ZJ05|URH1_ORYSJ Probable uridine nucleosidase 1 OS=Oryza sativa subsp. japonica GN=URH1 PE=2 SV=1 19 282 2.0E-12
sp|Q652Q8|URH2_ORYSJ Probable uridine nucleosidase 2 OS=Oryza sativa subsp. japonica GN=URH2 PE=2 SV=1 12 274 4.0E-12
sp|B7N5C5|RIHB_ECOLU Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rihB PE=3 SV=1 19 319 1.0E-11
sp|B6I8L3|RIHB_ECOSE Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli (strain SE11) GN=rihB PE=3 SV=1 19 319 2.0E-11
sp|A7ZNY5|RIHB_ECO24 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rihB PE=3 SV=1 19 319 3.0E-11
sp|C4ZU12|RIHB_ECOBW Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rihB PE=3 SV=1 19 319 3.0E-11
sp|B1X860|RIHB_ECODH Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli (strain K12 / DH10B) GN=rihB PE=3 SV=1 19 319 3.0E-11
sp|P33022|RIHB_ECOLI Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli (strain K12) GN=rihB PE=1 SV=1 19 319 3.0E-11
sp|B7LAI5|RIHB_ECO55 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli (strain 55989 / EAEC) GN=rihB PE=3 SV=1 19 319 3.0E-11
sp|B1LKQ9|RIHB_ECOSM Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rihB PE=3 SV=1 19 319 3.0E-11
sp|B7M510|RIHB_ECO8A Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O8 (strain IAI1) GN=rihB PE=3 SV=1 19 319 3.0E-11
sp|A8A225|RIHB_ECOHS Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O9:H4 (strain HS) GN=rihB PE=3 SV=1 19 319 3.0E-11
sp|B1IYA8|RIHB_ECOLC Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rihB PE=3 SV=1 19 319 3.0E-11
sp|B7NMX6|RIHB_ECO7I Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rihB PE=3 SV=1 19 319 3.0E-11
sp|A1AD20|RIHB_ECOK1 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O1:K1 / APEC GN=rihB PE=3 SV=1 19 319 4.0E-11
sp|B7UFH8|RIHB_ECO27 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rihB PE=3 SV=1 19 319 4.0E-11
sp|B7MF76|RIHB_ECO45 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rihB PE=3 SV=1 19 319 4.0E-11
sp|B7MX26|RIHB_ECO81 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O81 (strain ED1a) GN=rihB PE=3 SV=1 19 319 4.0E-11
sp|Q0TFS8|RIHB_ECOL5 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rihB PE=3 SV=1 19 319 4.0E-11
sp|Q8FFT8|RIHB_ECOL6 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rihB PE=3 SV=1 19 319 4.0E-11
sp|Q1R9R0|RIHB_ECOUT Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli (strain UTI89 / UPEC) GN=rihB PE=3 SV=1 19 319 4.0E-11
sp|B7LVC3|RIHB_ESCF3 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rihB PE=3 SV=1 19 319 4.0E-11
sp|Q3Z044|RIHB_SHISS Pyrimidine-specific ribonucleoside hydrolase RihB OS=Shigella sonnei (strain Ss046) GN=rihB PE=3 SV=1 19 319 4.0E-11
sp|Q83KF1|RIHB_SHIFL Pyrimidine-specific ribonucleoside hydrolase RihB OS=Shigella flexneri GN=rihB PE=3 SV=1 19 319 6.0E-11
sp|Q0T2W2|RIHB_SHIF8 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Shigella flexneri serotype 5b (strain 8401) GN=rihB PE=3 SV=1 19 319 6.0E-11
sp|B5YWV3|RIHB_ECO5E Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rihB PE=3 SV=1 19 319 1.0E-10
sp|Q8XE94|RIHB_ECO57 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O157:H7 GN=rihB PE=3 SV=1 19 319 1.0E-10
sp|Q31YW9|RIHB_SHIBS Putative pyrimidine-specific ribonucleoside hydrolase RihB OS=Shigella boydii serotype 4 (strain Sb227) GN=rihB PE=3 SV=1 145 319 3.0E-09
sp|Q32ER0|RIHB_SHIDS Putative pyrimidine-specific ribonucleoside hydrolase RihB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rihB PE=3 SV=1 143 319 9.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4993
MLSTVGLVALLATGARGGRRPKVILDNDWTATEFSPFLQALQAGWEVLGLTSGTCNSWALQSTLHGLATLEAGNL
SCIPVYRGADYPLLHNPGLAEAWALVHGELPWQGAFAAQNDTAEAQGRDPTGGDPGRTSRAALVEGYPNTSYVRG
TSAAEFLVQAVRRHPGEVMIYGAGALTNIALAHRIDPTFARNAKGLVVMGGYMDVNLIQATGSALVANLQSDINF
KLDPEGTKVVLTAPFPHITIVGNAANQVTPSEEYLEDLYRVKNPYTTLMYRYYDRDFPLWDATAAAVMIDPSIVT
NSTEFYVDVDTSFASPSYGNIHAYQENLKPKAQTLRKVRMVLSVDGEKLKQQVKQALQFPPTCAQLQRHSE*
Coding >Hirsu2|4993
ATGCTTTCGACAGTCGGGCTTGTAGCCCTCCTGGCGACGGGAGCCCGGGGCGGCAGGCGGCCCAAGGTGATACTC
GACAACGACTGGACGGCCACCGAGTTCAGCCCCTTCCTCCAGGCCCTCCAGGCCGGCTGGGAGGTGCTGGGCCTG
ACGAGCGGCACGTGCAACTCGTGGGCGCTGCAGTCGACGCTGCACGGGCTGGCGACGCTCGAGGCCGGCAACCTG
TCGTGCATCCCCGTCTACCGCGGCGCCGACTACCCGCTCCTGCACAACCCGGGCCTGGCCGAGGCCTGGGCCCTG
GTGCACGGCGAGCTGCCGTGGCAGGGGGCCTTCGCGGCGCAGAACGACACGGCCGAGGCGCAGGGCCGCGATCCG
ACGGGAGGCGACCCGGGCCGGACCTCGAGGGCGGCCTTGGTCGAGGGCTACCCCAACACCAGCTACGTCCGCGGC
ACGTCGGCCGCCGAGTTCCTGGTCCAGGCCGTGCGCCGGCACCCGGGCGAGGTCATGATCTACGGCGCCGGCGCC
CTGACCAACATCGCGCTGGCCCATCGCATCGACCCGACCTTTGCCCGCAACGCCAAGGGGCTCGTCGTCATGGGC
GGCTACATGGACGTCAACCTGATCCAGGCCACCGGCAGCGCCCTGGTCGCCAATCTCCAGTCCGACATCAACTTC
AAGCTGGATCCCGAGGGCACCAAGGTCGTCCTGACGGCCCCCTTCCCGCACATCACCATCGTAGGCAACGCCGCG
AACCAGGTCACGCCCTCGGAGGAGTACTTGGAGGACCTCTACCGGGTCAAGAATCCCTACACGACCCTGATGTAC
CGATACTACGATCGCGACTTTCCACTGTGGGACGCGACGGCGGCCGCCGTCATGATCGACCCGAGCATCGTCACC
AACTCGACCGAGTTCTACGTCGACGTCGACACGAGCTTCGCCTCTCCGTCCTACGGAAACATCCACGCCTACCAG
GAGAATCTCAAGCCCAAGGCCCAGACGTTGCGGAAAGTGCGCATGGTTCTGTCTGTCGATGGCGAGAAGCTGAAG
CAGCAAGTCAAGCAGGCCTTGCAGTTCCCTCCGACCTGTGCCCAGTTACAGCGGCACTCTGAGTAG
Transcript >Hirsu2|4993
ATGCTTTCGACAGTCGGGCTTGTAGCCCTCCTGGCGACGGGAGCCCGGGGCGGCAGGCGGCCCAAGGTGATACTC
GACAACGACTGGACGGCCACCGAGTTCAGCCCCTTCCTCCAGGCCCTCCAGGCCGGCTGGGAGGTGCTGGGCCTG
ACGAGCGGCACGTGCAACTCGTGGGCGCTGCAGTCGACGCTGCACGGGCTGGCGACGCTCGAGGCCGGCAACCTG
TCGTGCATCCCCGTCTACCGCGGCGCCGACTACCCGCTCCTGCACAACCCGGGCCTGGCCGAGGCCTGGGCCCTG
GTGCACGGCGAGCTGCCGTGGCAGGGGGCCTTCGCGGCGCAGAACGACACGGCCGAGGCGCAGGGCCGCGATCCG
ACGGGAGGCGACCCGGGCCGGACCTCGAGGGCGGCCTTGGTCGAGGGCTACCCCAACACCAGCTACGTCCGCGGC
ACGTCGGCCGCCGAGTTCCTGGTCCAGGCCGTGCGCCGGCACCCGGGCGAGGTCATGATCTACGGCGCCGGCGCC
CTGACCAACATCGCGCTGGCCCATCGCATCGACCCGACCTTTGCCCGCAACGCCAAGGGGCTCGTCGTCATGGGC
GGCTACATGGACGTCAACCTGATCCAGGCCACCGGCAGCGCCCTGGTCGCCAATCTCCAGTCCGACATCAACTTC
AAGCTGGATCCCGAGGGCACCAAGGTCGTCCTGACGGCCCCCTTCCCGCACATCACCATCGTAGGCAACGCCGCG
AACCAGGTCACGCCCTCGGAGGAGTACTTGGAGGACCTCTACCGGGTCAAGAATCCCTACACGACCCTGATGTAC
CGATACTACGATCGCGACTTTCCACTGTGGGACGCGACGGCGGCCGCCGTCATGATCGACCCGAGCATCGTCACC
AACTCGACCGAGTTCTACGTCGACGTCGACACGAGCTTCGCCTCTCCGTCCTACGGAAACATCCACGCCTACCAG
GAGAATCTCAAGCCCAAGGCCCAGACGTTGCGGAAAGTGCGCATGGTTCTGTCTGTCGATGGCGAGAAGCTGAAG
CAGCAAGTCAAGCAGGCCTTGCAGTTCCCTCCGACCTGTGCCCAGTTACAGCGGCACTCTGAGTAG
Gene >Hirsu2|4993
ATGCTTTCGACAGTCGGGCTTGTAGCCCTCCTGGCGACGGGAGCCCGGGGCGGCAGGCGGCCCAAGGTGATACTC
GACAACGACTGGACGGCCACCGAGTTCAGCCCCTTCCTCCAGGCCCTCCAGGCCGGCTGGGAGGTGCTGGGCCTG
ACGAGCGGCACGTGCAACTCGTGGGCGCTGCAGTCGACGCTGCACGGGCTGGCGACGCTCGAGGCCGGCAACCTG
TCGTGCATCCCCGTCTACCGCGGCGCCGACTACCCGCTCCTGCACAACCCGGGCCTGGCCGAGGCCTGGGCCCTG
GTGCACGGCGAGCTGCCGTGGCAGGGGGCCTTCGCGGCGCAGAACGACACGGCCGAGGCGCAGGGCCGCGATCCG
ACGGGAGGCGACCCGGGCCGGACCTCGAGGGCGGCCTTGGTCGAGGGCTACCCCAACACCAGCTACGTCCGCGGC
ACGTCGGCCGCCGAGTTCCTGGTCCAGGCCGTGCGCCGGCACCCGGGCGAGGTCATGATCTACGGCGCCGGCGCC
CTGACCAACATCGCGCTGGCCCATCGCATCGACCCGACCTTTGCCCGCAACGCCAAGGGGCTCGTCGTCATGGGC
GGCTACATGGACGTCAACCTGATCCAGGCCACCGGCAGCGCCCTGGTCGCCAATCTCCAGTCCGACATCAACTTC
AAGCTGGATCCCGAGGGCACCAAGGTCGTCCTGACGGCCCCCTTCCCGCACATCACCATCGTAGGCAACGCCGCG
AACCAGGTCACGCCCTCGGAGGAGTACTTGGAGGACCTCTACCGGGTCAAGAATCCCTACACGACCCTGATGTAC
CGATACTACGGTAAGGAGGGTTCTCCTCAGCCCCGATTTCTTTTTAAATGTGAGTGTCCGTCTCATCGCTGAGAT
ATGTGCTTGCCAGATCGCGACTTTCCACTGTGGGACGCGACGGCGGCCGCCGTCATGATCGACCCGAGCATCGTC
ACCAACTCGACCGAGTTCTACGTCGACGTCGACACGAGCTTCGCCTCTCCGTCCTACGGAAACATCCACGCCTAC
CAGGAGAATCTCAAGCCCAAGGCCCAGACGTTGCGGAAAGTGCGCATGGTTCTGTCTGTCGATGGCGAGAAGCTG
AAGCAGCAAGTCAAGCAGGCCTTGCAGTTCCCTCCGACCTGTGCCCAGTTACAGCGGCACTCTGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail