Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4990
Gene name
LocationContig_250:9906..11912
Strand-
Gene length (bp)2006
Transcript length (bp)1752
Coding sequence length (bp)1752
Protein length (aa) 584

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01794 Ferric_reduct Ferric reductase like transmembrane component 1.8E-17 121 233
PF08030 NAD_binding_6 Ferric reductase NAD binding domain 4.6E-17 370 563

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q04800|FRP1_SCHPO Ferric reductase transmembrane component 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=frp1 PE=1 SV=1 116 511 2.0E-21
sp|O94727|FRP2_SCHPO Ferric/cupric reductase transmembrane component 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=frp2 PE=3 SV=1 113 436 2.0E-19
sp|P78588|FREL_CANAX Probable ferric reductase transmembrane component OS=Candida albicans GN=CFL1 PE=3 SV=1 116 583 2.0E-18
sp|P36033|FRE2_YEAST Ferric/cupric reductase transmembrane component 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE2 PE=1 SV=1 116 581 3.0E-18
sp|Q5A446|FRE1_CANAL Ferric/cupric reductase transmembrane component 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CFL1 PE=2 SV=1 116 583 4.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q04800|FRP1_SCHPO Ferric reductase transmembrane component 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=frp1 PE=1 SV=1 116 511 2.0E-21
sp|O94727|FRP2_SCHPO Ferric/cupric reductase transmembrane component 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=frp2 PE=3 SV=1 113 436 2.0E-19
sp|P78588|FREL_CANAX Probable ferric reductase transmembrane component OS=Candida albicans GN=CFL1 PE=3 SV=1 116 583 2.0E-18
sp|P36033|FRE2_YEAST Ferric/cupric reductase transmembrane component 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE2 PE=1 SV=1 116 581 3.0E-18
sp|Q5A446|FRE1_CANAL Ferric/cupric reductase transmembrane component 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CFL1 PE=2 SV=1 116 583 4.0E-18
sp|Q08905|FRE3_YEAST Ferric reductase transmembrane component 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE3 PE=1 SV=1 65 583 6.0E-18
sp|P53746|FRE4_YEAST Ferric reductase transmembrane component 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE4 PE=2 SV=1 116 583 1.0E-17
sp|Q08908|FRE5_YEAST Ferric reductase transmembrane component 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE5 PE=2 SV=1 84 469 8.0E-15
sp|Q8RWS6|FRO6_ARATH Ferric reduction oxidase 6 OS=Arabidopsis thaliana GN=FRO6 PE=2 SV=1 119 444 1.0E-14
sp|Q3KTM0|FRO7_ARATH Ferric reduction oxidase 7, chloroplastic OS=Arabidopsis thaliana GN=FRO7 PE=2 SV=1 128 444 3.0E-13
sp|F4I4K7|FRO3_ARATH Ferric reduction oxidase 3, mitochondrial OS=Arabidopsis thaliana GN=FRO3 PE=2 SV=1 156 441 5.0E-08
sp|Q12473|FRE6_YEAST Ferric reductase transmembrane component 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE6 PE=1 SV=1 83 442 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.5

Transmembrane Domains

Domain # Start End Length
1 25 47 22
2 84 106 22
3 126 148 22
4 158 180 22
5 193 212 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4990
MAGGSTHDAAFVAKLDRRTRHNEKLLLYFILSMLAILLFFTLLHLARRPGGRQEQEGEKPCVVTRLSRSIRSVTL
RSAWGLPSLGHVIVVGVYVVVNLVIAFANLGRDDLPMITNVASRTAWLAMGNLIFVVLLALKNTPLAFLTAWSYE
RLNVLHRVAGYTTVALVVIHASCYSSYFVRGGRTEVLRKAEQIYGMLAGISFVLLAVAGAVVRRWWYELFYYLHV
TFWIVAVVTLGLHQPDLGEKAVVVTALVGAGWALDRLVRLARFAIYCPNNRVELAPLPNRGTRVTLAKAPAGAVS
GKHCFLWIPGIRACEAHPFTVVALDPLEFVVSSCDGFTHDLHRYALSHPGSLRRASVDGTYGTVPDPAAYDTVVL
VAGGTGASFTFGVALDMLQKLRDGESKHVVFVWAAKHSSHLDCFQDHLVTLRNDRRVSISLFVTRQAEPPTGPSS
AAPQPADGTSTRTTGADAEKGPVPSIRSQDSGLSMGSEKASPACRATPSTTAIEVQPQPQRRPAHIHGIPIAYER
PDVPALVRAALAQTPAHRRAVVLGCGPGALMKQVRNTTAASIRPEGPGVELHCEQFGW*
Coding >Hirsu2|4990
ATGGCTGGTGGATCAACTCACGATGCCGCTTTCGTCGCCAAGCTCGACCGGCGGACGCGCCACAACGAGAAGCTG
CTGCTCTACTTCATCCTGTCAATGCTCGCCATCCTTCTGTTCTTCACTCTGCTCCATCTTGCGCGTCGGCCTGGC
GGCCGGCAGGAACAAGAGGGCGAGAAGCCGTGTGTCGTGACGCGCCTTTCCCGAAGCATCAGGAGTGTGACGCTG
CGCAGCGCCTGGGGCCTTCCGTCGCTCGGCCACGTCATTGTCGTGGGAGTCTACGTCGTCGTCAACCTCGTAATC
GCTTTTGCTAACCTCGGCCGCGACGATTTGCCCATGATCACAAACGTGGCGTCCCGGACCGCCTGGCTCGCCATG
GGCAACCTCATCTTCGTCGTCCTCCTCGCGCTCAAGAACACGCCGCTGGCCTTCCTGACGGCCTGGTCGTACGAA
CGGCTCAACGTGCTCCACCGGGTGGCGGGCTACACGACGGTGGCGCTTGTCGTGATACACGCGAGCTGCTACTCG
TCGTACTTCGTGCGCGGCGGCCGCACCGAGGTGCTGCGCAAGGCCGAGCAGATCTACGGCATGCTGGCCGGCATC
TCCTTCGTGCTCCTGGCCGTGGCCGGCGCCGTCGTGCGCCGCTGGTGGTACGAGCTCTTCTACTACCTTCACGTC
ACCTTCTGGATCGTCGCCGTCGTCACCCTCGGTCTCCACCAGCCGGACCTGGGCGAGAAGGCCGTCGTCGTGACC
GCCCTGGTCGGCGCCGGCTGGGCCCTTGACCGCCTCGTCCGCCTCGCCCGCTTCGCCATCTACTGCCCCAACAAC
CGCGTCGAGCTCGCGCCGCTGCCCAACCGAGGCACGCGCGTGACGCTGGCCAAGGCGCCCGCCGGTGCCGTCTCG
GGGAAGCACTGCTTCCTGTGGATCCCCGGCATCCGCGCCTGTGAGGCCCATCCCTTCACCGTCGTCGCCCTCGAC
CCCCTCGAGTTTGTCGTCTCGTCGTGCGACGGCTTCACCCACGACCTGCACCGCTATGCCCTGTCCCACCCGGGC
TCGTTGCGCAGGGCATCGGTCGACGGCACCTACGGCACCGTGCCCGACCCCGCCGCCTACGACACCGTCGTCCTC
GTGGCCGGCGGCACCGGCGCCAGCTTCACCTTTGGCGTCGCCCTCGACATGCTCCAGAAGCTGCGCGACGGCGAG
AGCAAACACGTCGTCTTCGTATGGGCCGCCAAGCACAGCTCCCATCTCGATTGCTTCCAGGACCACCTCGTCACG
CTGAGGAACGACAGGCGTGTCTCGATCAGCTTGTTTGTCACGAGACAGGCCGAGCCACCGACGGGCCCGTCCAGC
GCGGCGCCGCAGCCCGCCGACGGCACCTCGACGCGGACGACGGGTGCCGACGCCGAGAAGGGCCCGGTCCCCAGC
ATCCGGTCCCAGGACTCGGGCCTCTCGATGGGCTCCGAGAAGGCGTCGCCGGCCTGCCGGGCCACGCCCTCGACG
ACAGCCATCGAGGTGCAGCCGCAGCCGCAGCGGCGGCCGGCCCACATCCACGGCATCCCGATCGCGTACGAGCGG
CCCGACGTGCCGGCCCTGGTGCGCGCCGCCCTCGCGCAAACACCGGCGCACCGGCGGGCCGTCGTCCTCGGCTGC
GGCCCCGGCGCGCTGATGAAGCAGGTGCGCAACACGACGGCCGCGAGCATCCGGCCCGAGGGGCCCGGCGTGGAG
CTCCACTGCGAGCAGTTTGGCTGGTGA
Transcript >Hirsu2|4990
ATGGCTGGTGGATCAACTCACGATGCCGCTTTCGTCGCCAAGCTCGACCGGCGGACGCGCCACAACGAGAAGCTG
CTGCTCTACTTCATCCTGTCAATGCTCGCCATCCTTCTGTTCTTCACTCTGCTCCATCTTGCGCGTCGGCCTGGC
GGCCGGCAGGAACAAGAGGGCGAGAAGCCGTGTGTCGTGACGCGCCTTTCCCGAAGCATCAGGAGTGTGACGCTG
CGCAGCGCCTGGGGCCTTCCGTCGCTCGGCCACGTCATTGTCGTGGGAGTCTACGTCGTCGTCAACCTCGTAATC
GCTTTTGCTAACCTCGGCCGCGACGATTTGCCCATGATCACAAACGTGGCGTCCCGGACCGCCTGGCTCGCCATG
GGCAACCTCATCTTCGTCGTCCTCCTCGCGCTCAAGAACACGCCGCTGGCCTTCCTGACGGCCTGGTCGTACGAA
CGGCTCAACGTGCTCCACCGGGTGGCGGGCTACACGACGGTGGCGCTTGTCGTGATACACGCGAGCTGCTACTCG
TCGTACTTCGTGCGCGGCGGCCGCACCGAGGTGCTGCGCAAGGCCGAGCAGATCTACGGCATGCTGGCCGGCATC
TCCTTCGTGCTCCTGGCCGTGGCCGGCGCCGTCGTGCGCCGCTGGTGGTACGAGCTCTTCTACTACCTTCACGTC
ACCTTCTGGATCGTCGCCGTCGTCACCCTCGGTCTCCACCAGCCGGACCTGGGCGAGAAGGCCGTCGTCGTGACC
GCCCTGGTCGGCGCCGGCTGGGCCCTTGACCGCCTCGTCCGCCTCGCCCGCTTCGCCATCTACTGCCCCAACAAC
CGCGTCGAGCTCGCGCCGCTGCCCAACCGAGGCACGCGCGTGACGCTGGCCAAGGCGCCCGCCGGTGCCGTCTCG
GGGAAGCACTGCTTCCTGTGGATCCCCGGCATCCGCGCCTGTGAGGCCCATCCCTTCACCGTCGTCGCCCTCGAC
CCCCTCGAGTTTGTCGTCTCGTCGTGCGACGGCTTCACCCACGACCTGCACCGCTATGCCCTGTCCCACCCGGGC
TCGTTGCGCAGGGCATCGGTCGACGGCACCTACGGCACCGTGCCCGACCCCGCCGCCTACGACACCGTCGTCCTC
GTGGCCGGCGGCACCGGCGCCAGCTTCACCTTTGGCGTCGCCCTCGACATGCTCCAGAAGCTGCGCGACGGCGAG
AGCAAACACGTCGTCTTCGTATGGGCCGCCAAGCACAGCTCCCATCTCGATTGCTTCCAGGACCACCTCGTCACG
CTGAGGAACGACAGGCGTGTCTCGATCAGCTTGTTTGTCACGAGACAGGCCGAGCCACCGACGGGCCCGTCCAGC
GCGGCGCCGCAGCCCGCCGACGGCACCTCGACGCGGACGACGGGTGCCGACGCCGAGAAGGGCCCGGTCCCCAGC
ATCCGGTCCCAGGACTCGGGCCTCTCGATGGGCTCCGAGAAGGCGTCGCCGGCCTGCCGGGCCACGCCCTCGACG
ACAGCCATCGAGGTGCAGCCGCAGCCGCAGCGGCGGCCGGCCCACATCCACGGCATCCCGATCGCGTACGAGCGG
CCCGACGTGCCGGCCCTGGTGCGCGCCGCCCTCGCGCAAACACCGGCGCACCGGCGGGCCGTCGTCCTCGGCTGC
GGCCCCGGCGCGCTGATGAAGCAGGTGCGCAACACGACGGCCGCGAGCATCCGGCCCGAGGGGCCCGGCGTGGAG
CTCCACTGCGAGCAGTTTGGCTGGTGA
Gene >Hirsu2|4990
ATGGCTGGTGGATCAACTCACGATGCCGCTTTCGTCGCCAAGCTCGACCGGCGGACGCGCCACAACGAGAAGCTG
CTGCTCTACTTCATCCTGTCAATGCTCGCCATCCTTCTGTTCTTCACTCTGCTCCATCTTGCGCGTCGGCCTGGC
GGCCGGCAGGAACAAGAGGGCGAGAAGCCGTGTGTCGTGACGCGCCTTTCCCGGTAAGACGAGTCCTTGCAAGCG
GCCCTCTCTTGGTTCGGTCACGGCGAGCTCGACGTTCTGACACGCGTCTCCCGGTCTTGTAGAAGCATCAGGAGT
GTGACGCTGCGCAGCGCCTGGGGCCTTCCGTCGCTCGGCCACGTCATTGTCGTGGGAGTCTACGTCGTCGTCAAC
CTCGTAATCGCTTTTGCTAACCTCGGCCGCGACGATTTGCCCATGATCACAAACGTGGCGTCCCGGACCGCCTGG
TACGCGAAGCAACCCTCTCTTCCCCTCTCACTCTCGAGCTCCCCCGTTCCTTGGCTCGTCGGCCCGTCGAGATGC
TGACGAGAGGGGCGAAAAACGCGGCAGGCTCGCCATGGGCAACCTCATCTTCGTCGTCCTCCTCGCGCTCAAGAA
CACGCCGCTGGCCTTCCTGACGGCCTGGTCGTACGAACGGCTCAACGTGCTCCACCGGGTGGCGGGCTACACGAC
GGTGGCGCTTGTCGTGATACACGCGAGCTGCTACTCGTCGTACTTCGTGCGCGGCGGCCGCACCGAGGTGCTGCG
CAAGGCCGAGCAGATCTACGGCATGCTGGCCGGCATCTCCTTCGTGCTCCTGGCCGTGGCCGGCGCCGTCGTGCG
CCGCTGGTGGTACGAGCTCTTCTACTACCTTCACGTCACCTTCTGGATCGTCGCCGTCGTCACCCTCGGTCTCCA
CCAGCCGGACCTGGGCGAGAAGGCCGTCGTCGTGACCGCCCTGGTCGGCGCCGGCTGGGCCCTTGACCGCCTCGT
CCGCCTCGCCCGCTTCGCCATCTACTGCCCCAACAACCGCGTCGAGCTCGCGCCGCTGCCCAACCGAGGCACGCG
CGTGACGCTGGCCAAGGCGCCCGCCGGTGCCGTCTCGGGGAAGCACTGCTTCCTGTGGATCCCCGGCATCCGCGC
CTGTGAGGCCCATCCCTTCACCGTCGTCGCCCTCGACCCCCTCGAGTTTGTCGTCTCGTCGTGCGACGGCTTCAC
CCACGACCTGCACCGCTATGCCCTGTCCCACCCGGGCTCGTTGCGCAGGGCATCGGTCGACGGCACCTACGGCAC
CGTGCCCGACCCCGCCGCCTACGACACCGTCGTCCTCGTGGCCGGCGGCACCGGCGCCAGCTTCACCTTTGGCGT
CGCCCTCGACATGCTCCAGAAGCTGCGCGACGGCGAGAGCAAACACGTCGTCTTCGTATGGGCCGCCAAGCACAG
CTGTGAGTGACCGCCTCCCCCGACGCACACGCGAGAGGCAGAAGCACTGACCAGCCGTGGCGCCGTCAGCCCATC
TCGATTGCTTCCAGGACCACCTCGTCACGCTGAGGAACGACAGGCGTGTCTCGATCAGCTTGTTTGTCACGAGAC
AGGCCGAGCCACCGACGGGCCCGTCCAGCGCGGCGCCGCAGCCCGCCGACGGCACCTCGACGCGGACGACGGGTG
CCGACGCCGAGAAGGGCCCGGTCCCCAGCATCCGGTCCCAGGACTCGGGCCTCTCGATGGGCTCCGAGAAGGCGT
CGCCGGCCTGCCGGGCCACGCCCTCGACGACAGCCATCGAGGTGCAGCCGCAGCCGCAGCGGCGGCCGGCCCACA
TCCACGGCATCCCGATCGCGTACGAGCGGCCCGACGTGCCGGCCCTGGTGCGCGCCGCCCTCGCGCAAACACCGG
CGCACCGGCGGGCCGTCGTCCTCGGCTGCGGCCCCGGCGCGCTGATGAAGCAGGTGCGCAACACGACGGCCGCGA
GCATCCGGCCCGAGGGGCCCGGCGTGGAGCTCCACTGCGAGCAGTTTGGCTGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail