Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4989
Gene name
LocationContig_250:6173..9132
Strand+
Gene length (bp)2959
Transcript length (bp)2904
Coding sequence length (bp)2904
Protein length (aa) 968

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P11551|FUCP_ECOLI L-fucose-proton symporter OS=Escherichia coli (strain K12) GN=fucP PE=1 SV=3 430 856 3.0E-14
sp|P0C105|GLUP_BRUAB Glucose/galactose transporter OS=Brucella abortus biovar 1 (strain 9-941) GN=gluP PE=3 SV=1 425 692 2.0E-13
sp|Q2YIJ8|GLUP_BRUA2 Glucose/galactose transporter OS=Brucella abortus (strain 2308) GN=gluP PE=3 SV=1 425 692 2.0E-13
sp|Q8YB48|GLUP_BRUME Glucose/galactose transporter OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gluP PE=3 SV=1 425 692 1.0E-11
sp|P44776|FUCP_HAEIN L-fucose permease OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fucP PE=3 SV=1 425 608 4.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 15 34 19
2 55 77 22
3 97 119 22
4 131 153 22
5 213 235 22
6 423 445 22
7 460 482 22
8 502 524 22
9 539 561 22
10 607 629 22
11 734 753 19
12 765 787 22
13 791 813 22
14 825 847 22
15 852 874 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4989
MDVDASGSDAPAPNRGPAVFAVTTATLVLSSAFVGARIVCRHFVVHNVSWDDRVMIFAWLIAFFLSFTIDLGTVN
GLGKHDADISQHDLSTLRHCEYVFSILYNPALMATKTSILIFYLRLAKNTQVVLRYASWATLVVVNVSGIVLTFM
NIFQCSPVQAAWMSDFSQSSTCIPLLTEFICAAPVNIVTDLAILALPIPVLTSMRLPSRQKTILVLTFTLGIFVT
IVDVVRIYYLQRAITDVPTGTSSDPESRFGGQADFAWNASLSLMWSAVEVNVGMACACVPTLKPLILKLLPSMLY
DPDGTRTSGESKGPSDSEMPLSRNRASVALPPPPPTAVALEPVRVDGEDVEAPVSAVDFFTAARTASLGSDPPRP
TAGVATRARTNCTVSTNATAENGVYFGFVNIRKPKSMLKANAAESLKYCTIVSILFFLWGFSYGLLNTLNNAVAA
VNRMTPAQTLGLTSAYFGGGYFFGPLLVGEWILRRDEHNRSKRHEKVDAENVGGFKVTFIVGLCIYGIGTIIFWP
SAVTNSYGGFMLSSFVVGFGLSVLEVGANAFMILCGPPEYGEMRLLLAQGVQAVGSVLSGLLADKIFFKGIAQDN
MSNSMTLINVQWTYLGITLLCVVLGLFFYYMPLPEVSDDELELSASQLPIDPKKRSLGGLQLRTVCLVLAVFAQY
TYVAAQESNSIFFRELMVGILPSHPRRTTRAVVGVGRSSSAQDPDRPPGIAISIPDYLLVGHTVFALSRFLVGYL
CYLSAKHPRLPQPRTYLTISVALSFLFALLPVVLRPANPDLLGVPVTLFFFAEGPTWPLIFAIGLRGQGLRTKRA
AAFITMGGSGPAFFPFVMYGIISTGGSVRTAFIVIIALQVALVVYPLFLELSGDARRLVDPCSDVRRVLQDDERS
VDEAVADRHRDHYKNNYGRRAREKTSGFFHRASRGLGAKFAAGSRKSSQQADAEHSEGSAASSPRPP*
Coding >Hirsu2|4989
ATGGACGTCGATGCCAGTGGCTCGGATGCCCCAGCGCCAAATCGTGGGCCCGCCGTCTTCGCCGTCACGACCGCC
ACGCTCGTCCTCTCGTCCGCCTTCGTCGGTGCCCGCATCGTCTGCCGCCACTTCGTCGTCCACAACGTCTCGTGG
GATGACAGGGTTATGATCTTCGCCTGGCTCATCGCCTTCTTCCTCTCCTTCACCATCGATCTCGGCACCGTCAAC
GGCCTGGGCAAGCACGACGCCGACATCTCCCAGCACGACCTGAGCACCTTGCGCCACTGCGAATATGTCTTCTCC
ATCCTATACAACCCGGCCCTGATGGCCACCAAGACCAGCATCTTAATCTTCTATCTGCGCCTTGCCAAGAACACC
CAGGTCGTCCTGCGCTACGCCTCGTGGGCCACTCTGGTCGTCGTCAACGTGTCCGGAATCGTCCTGACCTTTATG
AACATCTTCCAATGTAGCCCCGTCCAGGCCGCCTGGATGTCCGACTTCTCCCAGAGCTCGACGTGCATCCCGCTT
CTTACCGAGTTCATATGCGCCGCCCCCGTCAACATCGTCACCGACCTGGCCATCCTCGCCCTGCCCATCCCCGTC
CTTACCAGCATGCGTCTGCCGTCTCGGCAGAAGACGATCCTCGTCCTGACCTTCACGCTCGGCATCTTCGTCACC
ATCGTCGACGTCGTCCGCATCTATTACCTCCAGCGCGCCATCACCGACGTGCCCACGGGGACCTCATCCGATCCC
GAGTCGAGGTTCGGCGGCCAGGCCGATTTCGCCTGGAACGCCTCCCTGTCTCTCATGTGGAGCGCCGTCGAGGTC
AACGTCGGCATGGCCTGCGCCTGCGTCCCGACCCTCAAGCCCCTGATCCTCAAGCTCCTGCCTTCCATGCTGTAC
GACCCGGACGGCACCCGGACGAGCGGCGAGTCCAAGGGCCCGAGCGACTCCGAAATGCCCCTGTCGCGCAACCGA
GCGAGCGTCGCCCTCCCGCCGCCCCCGCCCACTGCCGTTGCGCTCGAGCCGGTGCGGGTCGACGGGGAAGACGTC
GAGGCGCCCGTCAGCGCCGTCGACTTCTTCACCGCCGCGCGCACCGCTTCCTTGGGGAGCGACCCGCCGCGGCCT
ACCGCCGGCGTGGCGACTCGTGCCCGCACAAACTGCACCGTCTCCACCAACGCCACGGCCGAGAACGGAGTCTAC
TTCGGCTTCGTCAATATCAGGAAGCCTAAGAGCATGCTCAAGGCCAATGCCGCAGAGTCCCTCAAGTACTGCACC
ATCGTCTCCATCCTCTTCTTCCTCTGGGGCTTCTCGTACGGCCTGCTCAACACGCTCAACAATGCCGTCGCCGCC
GTGAACCGGATGACGCCAGCCCAGACGCTCGGCTTGACGAGCGCCTACTTTGGCGGCGGCTACTTCTTCGGCCCC
TTGCTGGTCGGCGAGTGGATCCTGCGCCGGGACGAGCACAACCGCTCGAAGCGCCACGAGAAGGTGGATGCCGAG
AACGTGGGCGGCTTCAAAGTTACGTTCATCGTCGGCCTGTGCATCTACGGCATAGGCACCATCATCTTCTGGCCC
TCGGCAGTGACCAACTCGTACGGCGGCTTCATGCTCAGCAGCTTCGTCGTCGGCTTCGGGCTCTCGGTGCTCGAG
GTCGGCGCCAATGCCTTCATGATCCTCTGCGGCCCGCCCGAGTACGGCGAGATGCGACTCCTCCTGGCCCAGGGC
GTGCAGGCCGTCGGCAGCGTCCTCAGCGGCCTGCTGGCGGACAAGATCTTCTTCAAGGGGATCGCCCAGGACAAC
ATGTCGAACAGCATGACGCTCATCAACGTGCAGTGGACCTATCTGGGCATCACCCTGCTGTGCGTCGTCCTCGGC
CTCTTCTTCTACTACATGCCCCTTCCCGAGGTCAGCGACGACGAGCTCGAGCTCTCGGCGAGCCAGCTGCCCATT
GATCCGAAGAAACGGAGCCTCGGCGGCCTGCAGCTGCGGACCGTGTGCCTGGTGCTGGCTGTGTTCGCGCAGTAT
ACCTACGTCGCGGCCCAGGAGAGCAACAGCATCTTCTTCCGAGAGCTGATGGTCGGCATCCTACCCAGCCATCCG
CGGCGGACGACGCGCGCCGTCGTCGGCGTCGGCCGCTCGTCTTCCGCGCAGGACCCGGACAGGCCGCCGGGCATC
GCCATCTCGATACCCGACTACCTCCTCGTGGGGCACACCGTCTTTGCCCTCTCGCGCTTTCTCGTCGGCTACCTC
TGCTACCTCTCGGCCAAGCACCCTCGCCTGCCGCAGCCGCGGACCTACCTCACCATCAGCGTCGCCCTCAGCTTC
CTTTTCGCCCTCCTCCCCGTCGTGCTGCGGCCCGCCAATCCCGATCTGCTCGGCGTGCCCGTCACCCTCTTCTTC
TTCGCCGAGGGCCCCACCTGGCCGCTGATATTCGCCATCGGCCTGCGGGGCCAGGGCCTGCGAACGAAGCGTGCG
GCCGCCTTCATCACCATGGGAGGGTCCGGGCCGGCCTTCTTCCCCTTCGTCATGTACGGCATCATCTCCACGGGC
GGCTCCGTGCGGACGGCCTTCATCGTCATCATCGCCCTGCAAGTCGCCCTGGTCGTGTACCCGCTGTTCCTGGAG
CTGAGCGGGGACGCGAGGCGGCTCGTCGACCCGTGCTCGGACGTGCGGCGCGTGCTGCAGGACGACGAGCGCTCG
GTGGACGAGGCCGTCGCCGACAGGCACCGAGACCACTACAAAAACAACTACGGAAGGAGGGCGAGGGAGAAGACC
AGCGGCTTCTTCCACAGGGCATCCCGGGGCCTGGGAGCCAAGTTTGCCGCGGGGTCGCGGAAGTCGTCGCAGCAG
GCCGACGCGGAGCACAGCGAGGGCAGCGCCGCGAGCTCGCCACGACCGCCGTGA
Transcript >Hirsu2|4989
ATGGACGTCGATGCCAGTGGCTCGGATGCCCCAGCGCCAAATCGTGGGCCCGCCGTCTTCGCCGTCACGACCGCC
ACGCTCGTCCTCTCGTCCGCCTTCGTCGGTGCCCGCATCGTCTGCCGCCACTTCGTCGTCCACAACGTCTCGTGG
GATGACAGGGTTATGATCTTCGCCTGGCTCATCGCCTTCTTCCTCTCCTTCACCATCGATCTCGGCACCGTCAAC
GGCCTGGGCAAGCACGACGCCGACATCTCCCAGCACGACCTGAGCACCTTGCGCCACTGCGAATATGTCTTCTCC
ATCCTATACAACCCGGCCCTGATGGCCACCAAGACCAGCATCTTAATCTTCTATCTGCGCCTTGCCAAGAACACC
CAGGTCGTCCTGCGCTACGCCTCGTGGGCCACTCTGGTCGTCGTCAACGTGTCCGGAATCGTCCTGACCTTTATG
AACATCTTCCAATGTAGCCCCGTCCAGGCCGCCTGGATGTCCGACTTCTCCCAGAGCTCGACGTGCATCCCGCTT
CTTACCGAGTTCATATGCGCCGCCCCCGTCAACATCGTCACCGACCTGGCCATCCTCGCCCTGCCCATCCCCGTC
CTTACCAGCATGCGTCTGCCGTCTCGGCAGAAGACGATCCTCGTCCTGACCTTCACGCTCGGCATCTTCGTCACC
ATCGTCGACGTCGTCCGCATCTATTACCTCCAGCGCGCCATCACCGACGTGCCCACGGGGACCTCATCCGATCCC
GAGTCGAGGTTCGGCGGCCAGGCCGATTTCGCCTGGAACGCCTCCCTGTCTCTCATGTGGAGCGCCGTCGAGGTC
AACGTCGGCATGGCCTGCGCCTGCGTCCCGACCCTCAAGCCCCTGATCCTCAAGCTCCTGCCTTCCATGCTGTAC
GACCCGGACGGCACCCGGACGAGCGGCGAGTCCAAGGGCCCGAGCGACTCCGAAATGCCCCTGTCGCGCAACCGA
GCGAGCGTCGCCCTCCCGCCGCCCCCGCCCACTGCCGTTGCGCTCGAGCCGGTGCGGGTCGACGGGGAAGACGTC
GAGGCGCCCGTCAGCGCCGTCGACTTCTTCACCGCCGCGCGCACCGCTTCCTTGGGGAGCGACCCGCCGCGGCCT
ACCGCCGGCGTGGCGACTCGTGCCCGCACAAACTGCACCGTCTCCACCAACGCCACGGCCGAGAACGGAGTCTAC
TTCGGCTTCGTCAATATCAGGAAGCCTAAGAGCATGCTCAAGGCCAATGCCGCAGAGTCCCTCAAGTACTGCACC
ATCGTCTCCATCCTCTTCTTCCTCTGGGGCTTCTCGTACGGCCTGCTCAACACGCTCAACAATGCCGTCGCCGCC
GTGAACCGGATGACGCCAGCCCAGACGCTCGGCTTGACGAGCGCCTACTTTGGCGGCGGCTACTTCTTCGGCCCC
TTGCTGGTCGGCGAGTGGATCCTGCGCCGGGACGAGCACAACCGCTCGAAGCGCCACGAGAAGGTGGATGCCGAG
AACGTGGGCGGCTTCAAAGTTACGTTCATCGTCGGCCTGTGCATCTACGGCATAGGCACCATCATCTTCTGGCCC
TCGGCAGTGACCAACTCGTACGGCGGCTTCATGCTCAGCAGCTTCGTCGTCGGCTTCGGGCTCTCGGTGCTCGAG
GTCGGCGCCAATGCCTTCATGATCCTCTGCGGCCCGCCCGAGTACGGCGAGATGCGACTCCTCCTGGCCCAGGGC
GTGCAGGCCGTCGGCAGCGTCCTCAGCGGCCTGCTGGCGGACAAGATCTTCTTCAAGGGGATCGCCCAGGACAAC
ATGTCGAACAGCATGACGCTCATCAACGTGCAGTGGACCTATCTGGGCATCACCCTGCTGTGCGTCGTCCTCGGC
CTCTTCTTCTACTACATGCCCCTTCCCGAGGTCAGCGACGACGAGCTCGAGCTCTCGGCGAGCCAGCTGCCCATT
GATCCGAAGAAACGGAGCCTCGGCGGCCTGCAGCTGCGGACCGTGTGCCTGGTGCTGGCTGTGTTCGCGCAGTAT
ACCTACGTCGCGGCCCAGGAGAGCAACAGCATCTTCTTCCGAGAGCTGATGGTCGGCATCCTACCCAGCCATCCG
CGGCGGACGACGCGCGCCGTCGTCGGCGTCGGCCGCTCGTCTTCCGCGCAGGACCCGGACAGGCCGCCGGGCATC
GCCATCTCGATACCCGACTACCTCCTCGTGGGGCACACCGTCTTTGCCCTCTCGCGCTTTCTCGTCGGCTACCTC
TGCTACCTCTCGGCCAAGCACCCTCGCCTGCCGCAGCCGCGGACCTACCTCACCATCAGCGTCGCCCTCAGCTTC
CTTTTCGCCCTCCTCCCCGTCGTGCTGCGGCCCGCCAATCCCGATCTGCTCGGCGTGCCCGTCACCCTCTTCTTC
TTCGCCGAGGGCCCCACCTGGCCGCTGATATTCGCCATCGGCCTGCGGGGCCAGGGCCTGCGAACGAAGCGTGCG
GCCGCCTTCATCACCATGGGAGGGTCCGGGCCGGCCTTCTTCCCCTTCGTCATGTACGGCATCATCTCCACGGGC
GGCTCCGTGCGGACGGCCTTCATCGTCATCATCGCCCTGCAAGTCGCCCTGGTCGTGTACCCGCTGTTCCTGGAG
CTGAGCGGGGACGCGAGGCGGCTCGTCGACCCGTGCTCGGACGTGCGGCGCGTGCTGCAGGACGACGAGCGCTCG
GTGGACGAGGCCGTCGCCGACAGGCACCGAGACCACTACAAAAACAACTACGGAAGGAGGGCGAGGGAGAAGACC
AGCGGCTTCTTCCACAGGGCATCCCGGGGCCTGGGAGCCAAGTTTGCCGCGGGGTCGCGGAAGTCGTCGCAGCAG
GCCGACGCGGAGCACAGCGAGGGCAGCGCCGCGAGCTCGCCACGACCGCCGTGA
Gene >Hirsu2|4989
ATGGACGTCGATGCCAGTGGCTCGGATGCCCCAGCGCCAAATCGTGGGCCCGCCGTCTTCGCCGTCACGACCGCC
ACGCTCGTCCTCTCGTCCGCCTTCGTCGGTGCCCGCATCGTCTGCCGCCACTTCGTCGTCCACAACGTCTCGTGG
GATGACAGGGTTATGATCTTCGCCTGGCTCATCGCCTTCTTCCTCTCCTTCACCATCGATCTCGGCACCGTCAAC
GGCCTGGGCAAGCACGACGCCGACATCTCCCAGCACGACCTGAGCACCTTGCGCCACTGCGAATATGTCTTCTCC
ATCCTATACGTAAGTAGGCCAAGTCGCGCCCAGCCCCGGACGCGCCGCTGACGCCCTCGCACAGAACCCGGCCCT
GATGGCCACCAAGACCAGCATCTTAATCTTCTATCTGCGCCTTGCCAAGAACACCCAGGTCGTCCTGCGCTACGC
CTCGTGGGCCACTCTGGTCGTCGTCAACGTGTCCGGAATCGTCCTGACCTTTATGAACATCTTCCAATGTAGCCC
CGTCCAGGCCGCCTGGATGTCCGACTTCTCCCAGAGCTCGACGTGCATCCCGCTTCTTACCGAGTTCATATGCGC
CGCCCCCGTCAACATCGTCACCGACCTGGCCATCCTCGCCCTGCCCATCCCCGTCCTTACCAGCATGCGTCTGCC
GTCTCGGCAGAAGACGATCCTCGTCCTGACCTTCACGCTCGGCATCTTCGTCACCATCGTCGACGTCGTCCGCAT
CTATTACCTCCAGCGCGCCATCACCGACGTGCCCACGGGGACCTCATCCGATCCCGAGTCGAGGTTCGGCGGCCA
GGCCGATTTCGCCTGGAACGCCTCCCTGTCTCTCATGTGGAGCGCCGTCGAGGTCAACGTCGGCATGGCCTGCGC
CTGCGTCCCGACCCTCAAGCCCCTGATCCTCAAGCTCCTGCCTTCCATGCTGTACGACCCGGACGGCACCCGGAC
GAGCGGCGAGTCCAAGGGCCCGAGCGACTCCGAAATGCCCCTGTCGCGCAACCGAGCGAGCGTCGCCCTCCCGCC
GCCCCCGCCCACTGCCGTTGCGCTCGAGCCGGTGCGGGTCGACGGGGAAGACGTCGAGGCGCCCGTCAGCGCCGT
CGACTTCTTCACCGCCGCGCGCACCGCTTCCTTGGGGAGCGACCCGCCGCGGCCTACCGCCGGCGTGGCGACTCG
TGCCCGCACAAACTGCACCGTCTCCACCAACGCCACGGCCGAGAACGGAGTCTACTTCGGCTTCGTCAATATCAG
GAAGCCTAAGAGCATGCTCAAGGCCAATGCCGCAGAGTCCCTCAAGTACTGCACCATCGTCTCCATCCTCTTCTT
CCTCTGGGGCTTCTCGTACGGCCTGCTCAACACGCTCAACAATGCCGTCGCCGCCGTGAACCGGATGACGCCAGC
CCAGACGCTCGGCTTGACGAGCGCCTACTTTGGCGGCGGCTACTTCTTCGGCCCCTTGCTGGTCGGCGAGTGGAT
CCTGCGCCGGGACGAGCACAACCGCTCGAAGCGCCACGAGAAGGTGGATGCCGAGAACGTGGGCGGCTTCAAAGT
TACGTTCATCGTCGGCCTGTGCATCTACGGCATAGGCACCATCATCTTCTGGCCCTCGGCAGTGACCAACTCGTA
CGGCGGCTTCATGCTCAGCAGCTTCGTCGTCGGCTTCGGGCTCTCGGTGCTCGAGGTCGGCGCCAATGCCTTCAT
GATCCTCTGCGGCCCGCCCGAGTACGGCGAGATGCGACTCCTCCTGGCCCAGGGCGTGCAGGCCGTCGGCAGCGT
CCTCAGCGGCCTGCTGGCGGACAAGATCTTCTTCAAGGGGATCGCCCAGGACAACATGTCGAACAGCATGACGCT
CATCAACGTGCAGTGGACCTATCTGGGCATCACCCTGCTGTGCGTCGTCCTCGGCCTCTTCTTCTACTACATGCC
CCTTCCCGAGGTCAGCGACGACGAGCTCGAGCTCTCGGCGAGCCAGCTGCCCATTGATCCGAAGAAACGGAGCCT
CGGCGGCCTGCAGCTGCGGACCGTGTGCCTGGTGCTGGCTGTGTTCGCGCAGTATACCTACGTCGCGGCCCAGGA
GAGCAACAGCATCTTCTTCCGAGAGCTGATGGTCGGCATCCTACCCAGCCATCCGCGGCGGACGACGCGCGCCGT
CGTCGGCGTCGGCCGCTCGTCTTCCGCGCAGGACCCGGACAGGCCGCCGGGCATCGCCATCTCGATACCCGACTA
CCTCCTCGTGGGGCACACCGTCTTTGCCCTCTCGCGCTTTCTCGTCGGCTACCTCTGCTACCTCTCGGCCAAGCA
CCCTCGCCTGCCGCAGCCGCGGACCTACCTCACCATCAGCGTCGCCCTCAGCTTCCTTTTCGCCCTCCTCCCCGT
CGTGCTGCGGCCCGCCAATCCCGATCTGCTCGGCGTGCCCGTCACCCTCTTCTTCTTCGCCGAGGGCCCCACCTG
GCCGCTGATATTCGCCATCGGCCTGCGGGGCCAGGGCCTGCGAACGAAGCGTGCGGCCGCCTTCATCACCATGGG
AGGGTCCGGGCCGGCCTTCTTCCCCTTCGTCATGTACGGCATCATCTCCACGGGCGGCTCCGTGCGGACGGCCTT
CATCGTCATCATCGCCCTGCAAGTCGCCCTGGTCGTGTACCCGCTGTTCCTGGAGCTGAGCGGGGACGCGAGGCG
GCTCGTCGACCCGTGCTCGGACGTGCGGCGCGTGCTGCAGGACGACGAGCGCTCGGTGGACGAGGCCGTCGCCGA
CAGGCACCGAGACCACTACAAAAACAACTACGGAAGGAGGGCGAGGGAGAAGACCAGCGGCTTCTTCCACAGGGC
ATCCCGGGGCCTGGGAGCCAAGTTTGCCGCGGGGTCGCGGAAGTCGTCGCAGCAGGCCGACGCGGAGCACAGCGA
GGGCAGCGCCGCGAGCTCGCCACGACCGCCGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail