Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4988
Gene name
LocationContig_250:775..1754
Strand+
Gene length (bp)979
Transcript length (bp)843
Coding sequence length (bp)843
Protein length (aa) 281

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13520 AA_permease_2 Amino acid permease 1.7E-28 2 226

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P19807|HNM1_YEAST Choline transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNM1 PE=1 SV=1 1 276 4.0E-38
sp|O60113|YG64_SCHPO Uncharacterized amino-acid permease C15C4.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.04c PE=3 SV=1 3 250 2.0E-29
sp|O59942|AAP2_NEUCR Amino-acid permease 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aap-2 PE=2 SV=2 3 245 1.0E-24
sp|P53744|BIO5_YEAST 7-keto 8-aminopelargonic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BIO5 PE=1 SV=1 1 232 4.0E-20
sp|Q9ZU50|BAT1_ARATH Amino-acid permease BAT1 OS=Arabidopsis thaliana GN=BAT1 PE=2 SV=2 1 249 1.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P19807|HNM1_YEAST Choline transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNM1 PE=1 SV=1 1 276 4.0E-38
sp|O60113|YG64_SCHPO Uncharacterized amino-acid permease C15C4.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.04c PE=3 SV=1 3 250 2.0E-29
sp|O59942|AAP2_NEUCR Amino-acid permease 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aap-2 PE=2 SV=2 3 245 1.0E-24
sp|P53744|BIO5_YEAST 7-keto 8-aminopelargonic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BIO5 PE=1 SV=1 1 232 4.0E-20
sp|Q9ZU50|BAT1_ARATH Amino-acid permease BAT1 OS=Arabidopsis thaliana GN=BAT1 PE=2 SV=2 1 249 1.0E-18
sp|P36029|TPO5_YEAST Polyamine transporter TPO5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO5 PE=1 SV=1 3 248 5.0E-18
sp|Q9C0Z0|YKM2_SCHPO Uncharacterized amino-acid permease PB24D3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.02c PE=3 SV=1 1 268 2.0E-17
sp|Q9US40|YFZ1_SCHPO Uncharacterized amino-acid permease C1039.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.01 PE=3 SV=1 3 268 5.0E-17
sp|O74537|YCQ4_SCHPO Uncharacterized amino-acid permease C74.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC74.04 PE=3 SV=1 1 261 7.0E-15
sp|O59813|YCT3_SCHPO Uncharacterized amino-acid permease C794.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.03 PE=2 SV=1 3 235 9.0E-15
sp|P32837|UGA4_YEAST GABA-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UGA4 PE=1 SV=1 3 266 1.0E-14
sp|B9EXZ6|BAT1_ORYSJ Amino-acid permease BAT1 homolog OS=Oryza sativa subsp. japonica GN=BAT1 PE=2 SV=1 1 251 4.0E-14
sp|Q09887|YC9D_SCHPO Uncharacterized amino-acid permease C584.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC584.13 PE=3 SV=1 3 258 3.0E-12
sp|O74248|GPT1_CANAX Putative polyamine transporter OS=Candida albicans GN=GPT1 PE=3 SV=1 1 250 3.0E-11
sp|Q9UT18|THI9_SCHPO Thiamine transporter thi9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi9 PE=1 SV=1 3 230 2.0E-09
sp|Q10087|YAO8_SCHPO Uncharacterized amino-acid permease C11D3.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.08c PE=3 SV=1 5 263 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 65 87 22
3 114 136 22
4 141 163 22
5 183 205 22
6 217 236 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4988
MIEEIPEPHVQGPRILIYCILIGVGTGFVFLSCLLFCVRDMDRVINASYGPLLQIYMDATKSKAGSACLLMFPIV
GMVFTLTTLMCASSRMSYAFARDRGMPFSHLLARVHPRLGVPLNALLWTAAWVVVFGCIFLGSSSTFNAITAASV
VSLGLTYAIPPAVHLLRGRDLLPDSRSFKLPKPLGWAANIVGILWTILTTVLFVFPPRLPVTASNMNYCIVAFGV
ILLIAGLTWIFDGRKNYKGPKIDVQGLLDGKVEGIESEPVQAEPWLSNSMDKTPA*
Coding >Hirsu2|4988
ATGATCGAGGAGATACCCGAGCCGCACGTCCAGGGCCCGCGCATCCTCATCTACTGCATCCTCATCGGCGTCGGC
ACCGGCTTCGTCTTCCTCAGCTGCCTCCTCTTCTGCGTCCGCGACATGGACCGCGTCATCAACGCCAGCTACGGC
CCGCTGCTGCAGATCTACATGGACGCCACCAAGAGCAAGGCCGGCAGCGCGTGCCTGCTCATGTTCCCCATCGTC
GGCATGGTCTTCACCCTGACGACGCTCATGTGCGCCAGCAGCCGGATGAGCTACGCCTTCGCCCGCGACCGCGGC
ATGCCCTTCAGCCACCTCCTGGCCCGCGTCCACCCGCGCCTGGGCGTGCCGCTCAACGCCCTGCTCTGGACCGCC
GCCTGGGTCGTCGTCTTCGGCTGCATCTTCCTCGGCTCCAGCAGCACCTTCAACGCCATCACGGCCGCCTCCGTC
GTCTCCCTCGGCCTCACCTACGCCATCCCCCCGGCCGTCCACCTGCTGCGCGGCCGCGACCTGCTGCCGGACAGC
CGCTCCTTCAAGCTGCCGAAGCCGCTGGGCTGGGCCGCCAACATTGTCGGCATCCTGTGGACGATCCTGACGACG
GTGCTGTTCGTCTTCCCGCCCAGGCTCCCGGTCACGGCGAGCAACATGAACTACTGCATCGTCGCCTTTGGCGTC
ATCCTCCTCATCGCCGGCCTCACCTGGATCTTTGACGGACGCAAGAACTACAAGGGGCCCAAGATCGATGTCCAG
GGCCTTTTGGATGGCAAAGTAGAAGGCATCGAGTCGGAACCCGTCCAGGCCGAGCCCTGGCTCTCCAACTCGATG
GACAAGACCCCGGCCTGA
Transcript >Hirsu2|4988
ATGATCGAGGAGATACCCGAGCCGCACGTCCAGGGCCCGCGCATCCTCATCTACTGCATCCTCATCGGCGTCGGC
ACCGGCTTCGTCTTCCTCAGCTGCCTCCTCTTCTGCGTCCGCGACATGGACCGCGTCATCAACGCCAGCTACGGC
CCGCTGCTGCAGATCTACATGGACGCCACCAAGAGCAAGGCCGGCAGCGCGTGCCTGCTCATGTTCCCCATCGTC
GGCATGGTCTTCACCCTGACGACGCTCATGTGCGCCAGCAGCCGGATGAGCTACGCCTTCGCCCGCGACCGCGGC
ATGCCCTTCAGCCACCTCCTGGCCCGCGTCCACCCGCGCCTGGGCGTGCCGCTCAACGCCCTGCTCTGGACCGCC
GCCTGGGTCGTCGTCTTCGGCTGCATCTTCCTCGGCTCCAGCAGCACCTTCAACGCCATCACGGCCGCCTCCGTC
GTCTCCCTCGGCCTCACCTACGCCATCCCCCCGGCCGTCCACCTGCTGCGCGGCCGCGACCTGCTGCCGGACAGC
CGCTCCTTCAAGCTGCCGAAGCCGCTGGGCTGGGCCGCCAACATTGTCGGCATCCTGTGGACGATCCTGACGACG
GTGCTGTTCGTCTTCCCGCCCAGGCTCCCGGTCACGGCGAGCAACATGAACTACTGCATCGTCGCCTTTGGCGTC
ATCCTCCTCATCGCCGGCCTCACCTGGATCTTTGACGGACGCAAGAACTACAAGGGGCCCAAGATCGATGTCCAG
GGCCTTTTGGATGGCAAAGTAGAAGGCATCGAGTCGGAACCCGTCCAGGCCGAGCCCTGGCTCTCCAACTCGATG
GACAAGACCCCGGCCTGA
Gene >Hirsu2|4988
ATGATCGAGGAGATACCCGAGCCGCACGTCCAGGGCCCGCGCATCCTCATCTACTGCATCCTCATCGGCGTCGGC
ACCGGCTTCGTCTTCCTCAGCTGCCTCCTCTTCTGCGTCCGCGACATGGACCGCGTCATCAACGCCAGCTACGGC
CCGCTGCTGCAGATCTACATGGACGCCACCAAGAGCAAGGCCGGCAGCGCGTGCCTGCTCATGTTCCCCATCGTC
GGCATGGTCTTCACCCTGACGACGCTCATGTGCGCCAGCAGCCGGATGAGCTACGCCTTCGCCCGCGACCGCGGC
ATGCCCTTCAGCCACCTCCTGGCCCGCGTCCACCCGCGCCTGGGCGTGCCGCTCAACGCCCTGCTCTGGACCGCC
GCCTGGGTCGTCGTCTTCGGCTGCATCTTCCTCGGCTCCAGCAGCACCTTCAACGCCATCACGGCCGCCTCCGTC
GTCTCCCTCGGCCTCACCTACGCCATCCCCCCGGCCGTCCACCTGCTGCGCGGCCGCGACCTGCTGCCGGACAGC
CGCTCCTTCAAGCTGCCGAAGCCGCTGGGCTGGGCCGCCAACATTGTGAGATGAATTTTCTTTCTCTCCCTTTTC
CTCTTTTAGCCTCGCCTTTTTCACGACAAGGTGTTGCGGGACCGAGGGGGGGGGGGCAGAAGGGCGTGATGATGC
TGGGATAGAAACGGATGCTGACGGCGAGCAGGTCGGCATCCTGTGGACGATCCTGACGACGGTGCTGTTCGTCTT
CCCGCCCAGGCTCCCGGTCACGGCGAGCAACATGAACTACTGCATCGTCGCCTTTGGCGTCATCCTCCTCATCGC
CGGCCTCACCTGGATCTTTGACGGACGCAAGAACTACAAGGGGCCCAAGATCGATGTCCAGGGCCTTTTGGATGG
CAAAGTAGAAGGCATCGAGTCGGAACCCGTCCAGGCCGAGCCCTGGCTCTCCAACTCGATGGACAAGACCCCGGC
CTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail