Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4985
Gene name
LocationContig_25:56785..59338
Strand+
Gene length (bp)2553
Transcript length (bp)2322
Coding sequence length (bp)2322
Protein length (aa) 774

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13854 Kelch_5 Kelch motif 4.5E-11 330 378

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AYG1|KLDC1_ARTBC Kelch repeat-containing protein ARB_01230 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01230 PE=1 SV=1 110 472 2.0E-23

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 526 548 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4985
MWSYGGLFFAHLASLAAPVVAQLGPWQDHQINTTICFWKQPRAALLRDTVYLDGGNIFWTPGLDSGVLGDAVNLG
NLQGLVLSYNLSEPFTPATNVTEILLKNAETKTRGSKNPGLSDFPNAYDGGMLANDAEFFLYGGTLFRDDTLYSL
PAADAVMEYQAYRYGADKPLMPLGFRSTHLNGGVNSYIAFGAAANAPSENKAWYFSGLTSPTRGPIYANPSLNGS
TSAKNISNTLITLDMTTQLEEKWSNATLPKDIKGRSNAEVVWVPVGRQGILVVLGGVVYPEWATIIHQSENKAAS
EKESPEFMRVIDIYDIAGDKWYKQPTQAGPGTRSRGCAVVAPAADYSSFNIYYYGGFDGIHPMGSFYDDVWVLSL
PSFTWTQINKGVDLHARSGHKCFLPYPDQMMVFGGYASEPGEVPSCLDKGPIVLFNISSGEWMDSYDPKKYGKYA
VPEKVRAAIGGDGSGGATATAPVPSGWATSGLADVFAQKYDTHKIKEYWPYGSASAAGGPGLPVEEKESDGDRKR
VLIPAILVPIVFLAGAAVVAWWCCRNGKSFGGKTSRSSGSDEAAMRIRSWVWGQAAGKSVTMTSSAASPDPEMAK
TASSVHSCPAPEPSPHHEMADTQLVELGDTSPPAELHDTGLSPIEVIQKHSNFASNRARSPTVPSQNSMSGLGDN
GSFVSRTSGAANSARLDSPLLGATSLADGIARPFAPGAGGEGQRRDALPPMSEEQAPVSPPTTGDELTGIDYLSA
GESPVLPGGSAVRENNAGEGRSK*
Coding >Hirsu2|4985
ATGTGGTCCTATGGCGGACTCTTCTTCGCCCATCTCGCCTCCTTGGCAGCGCCGGTCGTGGCCCAGCTCGGGCCT
TGGCAAGATCACCAGATTAATACGACCATTTGCTTCTGGAAACAGCCTCGAGCCGCCCTGTTAAGGGACACGGTC
TACCTCGATGGAGGCAACATCTTTTGGACGCCTGGCCTCGACTCGGGTGTTTTGGGAGATGCCGTCAACCTAGGC
AATCTTCAAGGCCTCGTCCTCTCGTATAACCTGAGCGAGCCTTTCACGCCCGCCACAAACGTCACGGAAATCCTA
CTAAAGAATGCCGAGACCAAGACCAGAGGAAGCAAAAACCCCGGTCTCAGCGACTTCCCCAATGCATATGACGGA
GGTATGCTTGCCAACGATGCCGAGTTCTTCCTTTACGGCGGAACGCTGTTCAGGGACGATACCCTTTACAGCCTC
CCCGCCGCGGATGCCGTGATGGAATACCAGGCATACCGCTATGGCGCAGACAAGCCGCTGATGCCACTTGGCTTT
CGATCGACTCATCTCAATGGCGGAGTCAACTCGTACATCGCCTTCGGAGCGGCAGCCAATGCCCCCTCCGAGAAC
AAGGCGTGGTACTTCTCCGGCCTCACTTCTCCGACACGCGGGCCAATATATGCGAACCCGAGTCTCAACGGATCG
ACCAGCGCCAAGAACATCTCCAATACGCTCATCACTCTGGACATGACCACGCAGCTGGAGGAGAAGTGGAGCAAT
GCCACTTTGCCGAAAGACATCAAAGGCCGTTCCAATGCCGAGGTTGTCTGGGTTCCCGTCGGTAGGCAAGGGATT
CTCGTCGTACTCGGCGGCGTGGTATATCCCGAGTGGGCCACCATTATCCATCAGTCTGAAAACAAGGCCGCAAGC
GAAAAGGAGAGCCCTGAATTCATGCGCGTCATCGACATTTACGACATCGCCGGCGACAAGTGGTACAAACAGCCG
ACCCAAGCAGGGCCGGGGACACGCAGCCGAGGCTGCGCCGTCGTGGCCCCAGCGGCCGACTATTCGAGCTTCAAC
ATATACTACTACGGCGGATTCGACGGGATTCATCCGATGGGCAGCTTCTACGATGATGTCTGGGTCCTCTCGCTG
CCCTCCTTCACCTGGACTCAGATCAACAAGGGCGTTGATCTACACGCGCGCTCCGGCCACAAATGCTTCTTGCCA
TATCCGGACCAAATGATGGTCTTTGGCGGCTACGCTTCAGAGCCCGGTGAAGTCCCCTCCTGTTTGGACAAGGGG
CCTATAGTCCTCTTCAATATAAGCAGCGGAGAGTGGATGGACTCGTACGATCCGAAAAAGTACGGCAAATACGCG
GTTCCCGAGAAAGTGCGAGCTGCGATCGGCGGCGATGGGTCGGGCGGCGCGACGGCTACGGCACCCGTGCCTTCG
GGCTGGGCAACGAGCGGGTTGGCCGACGTCTTCGCGCAGAAGTACGACACTCACAAGATCAAGGAGTACTGGCCC
TACGGTTCCGCATCCGCCGCGGGCGGGCCCGGACTTCCCGTCGAGGAGAAGGAGAGTGACGGCGATCGGAAACGG
GTCCTCATTCCCGCGATTCTCGTCCCCATCGTCTTCCTCGCCGGAGCCGCCGTCGTTGCATGGTGGTGCTGTCGA
AACGGAAAGAGCTTCGGAGGCAAGACGTCGAGAAGCTCCGGCTCGGACGAGGCTGCGATGCGCATCCGGTCTTGG
GTCTGGGGTCAGGCCGCTGGGAAGTCGGTGACGATGACGAGCTCGGCTGCATCGCCGGACCCTGAGATGGCAAAG
ACTGCTTCCTCCGTCCACTCGTGCCCTGCGCCCGAACCATCCCCCCACCACGAGATGGCCGATACGCAGCTGGTG
GAACTGGGAGACACTTCACCGCCTGCGGAGCTCCACGATACAGGTCTCTCACCGATCGAGGTGATTCAGAAGCAT
TCGAACTTTGCGTCCAACAGGGCCCGGTCGCCAACGGTGCCTTCTCAGAACTCCATGTCTGGCCTCGGAGACAAT
GGCAGCTTCGTGTCCCGGACCTCGGGGGCGGCCAACAGTGCTCGTCTCGACTCGCCCTTGCTTGGGGCCACGTCC
CTCGCGGATGGAATAGCCAGGCCTTTTGCCCCGGGCGCAGGAGGCGAGGGCCAGCGTAGGGATGCATTGCCGCCC
ATGTCCGAAGAGCAGGCGCCCGTCTCCCCACCGACAACAGGCGACGAGCTGACGGGCATCGACTACCTTTCCGCT
GGCGAATCGCCAGTCTTGCCTGGCGGAAGCGCAGTTCGCGAAAACAATGCGGGCGAGGGCAGATCAAAGTGA
Transcript >Hirsu2|4985
ATGTGGTCCTATGGCGGACTCTTCTTCGCCCATCTCGCCTCCTTGGCAGCGCCGGTCGTGGCCCAGCTCGGGCCT
TGGCAAGATCACCAGATTAATACGACCATTTGCTTCTGGAAACAGCCTCGAGCCGCCCTGTTAAGGGACACGGTC
TACCTCGATGGAGGCAACATCTTTTGGACGCCTGGCCTCGACTCGGGTGTTTTGGGAGATGCCGTCAACCTAGGC
AATCTTCAAGGCCTCGTCCTCTCGTATAACCTGAGCGAGCCTTTCACGCCCGCCACAAACGTCACGGAAATCCTA
CTAAAGAATGCCGAGACCAAGACCAGAGGAAGCAAAAACCCCGGTCTCAGCGACTTCCCCAATGCATATGACGGA
GGTATGCTTGCCAACGATGCCGAGTTCTTCCTTTACGGCGGAACGCTGTTCAGGGACGATACCCTTTACAGCCTC
CCCGCCGCGGATGCCGTGATGGAATACCAGGCATACCGCTATGGCGCAGACAAGCCGCTGATGCCACTTGGCTTT
CGATCGACTCATCTCAATGGCGGAGTCAACTCGTACATCGCCTTCGGAGCGGCAGCCAATGCCCCCTCCGAGAAC
AAGGCGTGGTACTTCTCCGGCCTCACTTCTCCGACACGCGGGCCAATATATGCGAACCCGAGTCTCAACGGATCG
ACCAGCGCCAAGAACATCTCCAATACGCTCATCACTCTGGACATGACCACGCAGCTGGAGGAGAAGTGGAGCAAT
GCCACTTTGCCGAAAGACATCAAAGGCCGTTCCAATGCCGAGGTTGTCTGGGTTCCCGTCGGTAGGCAAGGGATT
CTCGTCGTACTCGGCGGCGTGGTATATCCCGAGTGGGCCACCATTATCCATCAGTCTGAAAACAAGGCCGCAAGC
GAAAAGGAGAGCCCTGAATTCATGCGCGTCATCGACATTTACGACATCGCCGGCGACAAGTGGTACAAACAGCCG
ACCCAAGCAGGGCCGGGGACACGCAGCCGAGGCTGCGCCGTCGTGGCCCCAGCGGCCGACTATTCGAGCTTCAAC
ATATACTACTACGGCGGATTCGACGGGATTCATCCGATGGGCAGCTTCTACGATGATGTCTGGGTCCTCTCGCTG
CCCTCCTTCACCTGGACTCAGATCAACAAGGGCGTTGATCTACACGCGCGCTCCGGCCACAAATGCTTCTTGCCA
TATCCGGACCAAATGATGGTCTTTGGCGGCTACGCTTCAGAGCCCGGTGAAGTCCCCTCCTGTTTGGACAAGGGG
CCTATAGTCCTCTTCAATATAAGCAGCGGAGAGTGGATGGACTCGTACGATCCGAAAAAGTACGGCAAATACGCG
GTTCCCGAGAAAGTGCGAGCTGCGATCGGCGGCGATGGGTCGGGCGGCGCGACGGCTACGGCACCCGTGCCTTCG
GGCTGGGCAACGAGCGGGTTGGCCGACGTCTTCGCGCAGAAGTACGACACTCACAAGATCAAGGAGTACTGGCCC
TACGGTTCCGCATCCGCCGCGGGCGGGCCCGGACTTCCCGTCGAGGAGAAGGAGAGTGACGGCGATCGGAAACGG
GTCCTCATTCCCGCGATTCTCGTCCCCATCGTCTTCCTCGCCGGAGCCGCCGTCGTTGCATGGTGGTGCTGTCGA
AACGGAAAGAGCTTCGGAGGCAAGACGTCGAGAAGCTCCGGCTCGGACGAGGCTGCGATGCGCATCCGGTCTTGG
GTCTGGGGTCAGGCCGCTGGGAAGTCGGTGACGATGACGAGCTCGGCTGCATCGCCGGACCCTGAGATGGCAAAG
ACTGCTTCCTCCGTCCACTCGTGCCCTGCGCCCGAACCATCCCCCCACCACGAGATGGCCGATACGCAGCTGGTG
GAACTGGGAGACACTTCACCGCCTGCGGAGCTCCACGATACAGGTCTCTCACCGATCGAGGTGATTCAGAAGCAT
TCGAACTTTGCGTCCAACAGGGCCCGGTCGCCAACGGTGCCTTCTCAGAACTCCATGTCTGGCCTCGGAGACAAT
GGCAGCTTCGTGTCCCGGACCTCGGGGGCGGCCAACAGTGCTCGTCTCGACTCGCCCTTGCTTGGGGCCACGTCC
CTCGCGGATGGAATAGCCAGGCCTTTTGCCCCGGGCGCAGGAGGCGAGGGCCAGCGTAGGGATGCATTGCCGCCC
ATGTCCGAAGAGCAGGCGCCCGTCTCCCCACCGACAACAGGCGACGAGCTGACGGGCATCGACTACCTTTCCGCT
GGCGAATCGCCAGTCTTGCCTGGCGGAAGCGCAGTTCGCGAAAACAATGCGGGCGAGGGCAGATCAAAGTGA
Gene >Hirsu2|4985
ATGTGGTCCTATGGCGGACTCTTCTTCGCCCATCTCGCCTCCTTGGCAGCGCCGGTCGTGGCCCAGCTCGGGCCT
TGGCAAGATCACCAGATTAATACGACCATTTGCTTCTGGAAACAGCCTCGAGGTAGGATGTTCGAGCGACGCGAG
TGAAGAAGGTACCATACTGAATGGCGCCGCCCAGCCGCCCTGTTAAGGGACACGGTCTACCTCGATGGAGGCAAC
ATCTTTTGGACGCCTGGCCTCGACTCGGGTGTTTTGGGAGATGCCGTCAACCTAGGTTTGTCGGAACTCTATCAT
CCATCCACAGCGACTTGTAGCTAACTCGACAAAGGCAATCTTCAAGGCCTCGTCCTCTCGTATAACCTGAGCGAG
CCTTTCACGCCCGCCACAAACGTCACGGAAATCCTACTAAAGAATGCCGAGACCAAGACCAGAGGAAGCAAAAAC
CCCGGTCTCAGCGACTTCCCCAATGCATATGACGGAGGTATGCTTGCCAACGATGCCGAGTTCTTCCTTTACGGC
GGAACGCTGTTCAGGGACGATACCCTTTACAGCCTCCCCGCCGCGGATGCCGTGATGGAATACCAGGCATACCGC
TATGGCGCAGACAAGCCGCTGATGCCACTTGGCTTTCGATCGACTCATCTCAATGGCGGAGTCAACTCGTACATC
GCCTTCGGAGCGGCAGCCAATGCCCCCTCCGAGAACAAGGCGTGGTACTTCTCCGGCCTCACTTCTCCGACACGC
GGGCCAATATATGCGAACCCGAGTCTCAACGGATCGACCAGCGCCAAGAACATCTCCAATACGCTCATCACTCTG
GACATGACCACGCAGCTGGAGGAGAAGTGGAGCAATGCCACTTTGCCGAAAGACATCAAAGGCCGTTCCAATGCC
GAGGTTGTCTGGGTTCCCGTCGGTAGGCAAGGGATTCTCGTCGTACTCGGCGGCGTGGTATATCCCGAGTGGGCC
ACCATTATCCATCAGTCTGAAAACAAGGCCGCAAGCGTGAGTTTGGTGCCATGCCGCCATCCAAACATCGGTTCC
ACGATGCTGACTTATCGTTACAGGAAAAGGAGAGCCCTGAATTCATGCGCGTCATCGACATTTACGACATCGCCG
GCGACAAGTGGTACAAACAGCCGACCCAAGCAGGGCCGGGGACACGCAGCCGAGGCTGCGCCGTCGTGGCCCCAG
CGGCCGACTATTCGAGCTTCAACATATACTACTACGGCGGATTCGACGGGATTCATCCGATGGGCAGCTTCTACG
ATGATGTCTGGGTCCTCTCGCTGCCCTCCTTCACCTGGACTCAGATCAACAAGGGCGTTGATCTACACGCGCGCT
CCGGCCACAAATGCTTCTTGCCATATCCGGACCAAATGATGGTCTTTGGCGGCTACGCTTCAGAGCCCGGTGAAG
TCCCCTCCTGTTTGGACAAGGGGCCTATAGTCCTCTTCAATATAAGCAGCGGAGAGTGGATGGACTCGTACGATC
CGAAAAAGTACGGCAAATACGCGGTTCCCGAGAAAGTGCGAGCTGCGATCGGCGGCGATGGGTCGGGCGGCGCGA
CGGCTACGGCACCCGTGCCTTCGGGCTGGGCAACGAGCGGGTTGGCCGACGTCTTCGCGCAGAAGTACGACACTC
ACAAGATCAAGGAGTACTGGCCCTACGGTTCCGCATCCGCCGCGGGCGGGCCCGGACTTCCCGTCGAGGAGAAGG
AGAGTGACGGCGATCGGAAACGGGTCCTCATTCCCGCGATTCTCGTCCCCATCGTCTTCCTCGCCGGAGCCGCCG
TCGTTGCATGGTGGTGCTGTCGAAACGGAAAGAGCTTCGGAGGCAAGACGTCGAGAAGCTCCGGCTCGGACGAGG
CTGCGATGCGCATCCGGTCTTGGGTCTGGGGTCAGGCCGCTGGGAAGTCGGTGACGATGACGAGCTCGGCTGCAT
CGCCGGACCCTGAGATGGCAAAGACTGCTTCCTCCGTCCACTCGTGCCCTGCGCCCGAACCATCCCCCCACCACG
AGATGGCCGATACGCAGCTGGTGGAACTGGGAGGTGAGTTTCCCGCAGGATCGCCGATGCGCGCTGGGAGCAGCG
GTGCTGACGGACGCAGACACTTCACCGCCTGCGGAGCTCCACGATACAGGTCTCTCACCGATCGAGGTGATTCAG
AAGCATTCGAACTTTGCGTCCAACAGGGCCCGGTCGCCAACGGTGCCTTCTCAGAACTCCATGTCTGGCCTCGGA
GACAATGGCAGCTTCGTGTCCCGGACCTCGGGGGCGGCCAACAGTGCTCGTCTCGACTCGCCCTTGCTTGGGGCC
ACGTCCCTCGCGGATGGAATAGCCAGGCCTTTTGCCCCGGGCGCAGGAGGCGAGGGCCAGCGTAGGGATGCATTG
CCGCCCATGTCCGAAGAGCAGGCGCCCGTCTCCCCACCGACAACAGGCGACGAGCTGACGGGCATCGACTACCTT
TCCGCTGGCGAATCGCCAGTCTTGCCTGGCGGAAGCGCAGTTCGCGAAAACAATGCGGGCGAGGGCAGATCAAAG
TGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail