Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4978
Gene name
LocationContig_25:30973..32089
Strand-
Gene length (bp)1116
Transcript length (bp)951
Coding sequence length (bp)951
Protein length (aa) 317

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 4.3E-25 10 251
PF07714 Pkinase_Tyr Protein tyrosine kinase 3.5E-10 13 264

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06486|KC1D_RAT Casein kinase I isoform delta OS=Rattus norvegicus GN=Csnk1d PE=1 SV=2 3 288 4.0E-105
sp|Q9DC28|KC1D_MOUSE Casein kinase I isoform delta OS=Mus musculus GN=Csnk1d PE=1 SV=2 3 288 4.0E-105
sp|P48730|KC1D_HUMAN Casein kinase I isoform delta OS=Homo sapiens GN=CSNK1D PE=1 SV=2 3 288 4.0E-105
sp|P35508|KC1D_BOVIN Casein kinase I isoform delta OS=Bos taurus GN=CSNK1D PE=2 SV=2 3 288 4.0E-105
sp|Q5RC72|KC1D_PONAB Casein kinase I isoform delta OS=Pongo abelii GN=CSNK1D PE=2 SV=1 3 288 6.0E-105
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06486|KC1D_RAT Casein kinase I isoform delta OS=Rattus norvegicus GN=Csnk1d PE=1 SV=2 3 288 4.0E-105
sp|Q9DC28|KC1D_MOUSE Casein kinase I isoform delta OS=Mus musculus GN=Csnk1d PE=1 SV=2 3 288 4.0E-105
sp|P48730|KC1D_HUMAN Casein kinase I isoform delta OS=Homo sapiens GN=CSNK1D PE=1 SV=2 3 288 4.0E-105
sp|P35508|KC1D_BOVIN Casein kinase I isoform delta OS=Bos taurus GN=CSNK1D PE=2 SV=2 3 288 4.0E-105
sp|Q5RC72|KC1D_PONAB Casein kinase I isoform delta OS=Pongo abelii GN=CSNK1D PE=2 SV=1 3 288 6.0E-105
sp|Q7T2E3|KC1DA_DANRE Casein kinase I isoform delta-A OS=Danio rerio GN=csnk1da PE=2 SV=1 3 288 7.0E-105
sp|Q5BP74|KC1D_XENLA Casein kinase I isoform delta OS=Xenopus laevis GN=csnk1d PE=1 SV=2 3 288 1.0E-104
sp|Q6P647|KC1D_XENTR Casein kinase I isoform delta OS=Xenopus tropicalis GN=csnk1d PE=2 SV=1 3 288 2.0E-104
sp|Q6P3K7|KC1DB_DANRE Casein kinase I isoform delta-B OS=Danio rerio GN=csnk1db PE=2 SV=1 3 288 2.0E-104
sp|Q9JMK2|KC1E_MOUSE Casein kinase I isoform epsilon OS=Mus musculus GN=Csnk1e PE=1 SV=2 3 288 5.0E-103
sp|P49674|KC1E_HUMAN Casein kinase I isoform epsilon OS=Homo sapiens GN=CSNK1E PE=1 SV=1 3 288 1.0E-102
sp|Q5ZLL1|KC1E_CHICK Casein kinase I isoform epsilon OS=Gallus gallus GN=CSNK1E PE=2 SV=2 3 288 2.0E-102
sp|P40235|HHP1_SCHPO Casein kinase I homolog hhp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hhp1 PE=2 SV=1 3 287 2.0E-102
sp|O76324|DCO_DROME Discs overgrown protein kinase OS=Drosophila melanogaster GN=dco PE=1 SV=2 3 288 8.0E-102
sp|Q6QNM1|KC1_TOXGO Casein kinase I OS=Toxoplasma gondii PE=2 SV=1 3 284 2.0E-99
sp|Q6QNL9|KC1_EIMTE Casein kinase I OS=Eimeria tenella PE=2 SV=1 3 284 7.0E-99
sp|P67963|KC1A_XENLA Casein kinase I isoform alpha OS=Xenopus laevis GN=csnk1a1 PE=2 SV=1 3 311 9.0E-98
sp|P67962|KC1A_CHICK Casein kinase I isoform alpha OS=Gallus gallus GN=CSNK1A1 PE=2 SV=1 3 311 9.0E-98
sp|Q8BK63|KC1A_MOUSE Casein kinase I isoform alpha OS=Mus musculus GN=Csnk1a1 PE=1 SV=2 3 311 9.0E-98
sp|P48729|KC1A_HUMAN Casein kinase I isoform alpha OS=Homo sapiens GN=CSNK1A1 PE=1 SV=2 3 311 9.0E-98
sp|P67829|KC1A_SHEEP Casein kinase I isoform alpha OS=Ovis aries GN=CSNK1A1 PE=3 SV=1 3 309 4.0E-97
sp|P67828|KC1A_RABIT Casein kinase I isoform alpha OS=Oryctolagus cuniculus GN=CSNK1A1 PE=1 SV=1 3 309 4.0E-97
sp|P67827|KC1A_BOVIN Casein kinase I isoform alpha OS=Bos taurus GN=CSNK1A1 PE=1 SV=1 3 309 4.0E-97
sp|Q556Y4|KC1_DICDI Casein kinase I OS=Dictyostelium discoideum GN=cak1-1 PE=1 SV=1 3 294 7.0E-97
sp|P97633|KC1A_RAT Casein kinase I isoform alpha OS=Rattus norvegicus GN=Csnk1a1 PE=2 SV=1 3 309 1.0E-96
sp|P42158|KC1D_ARATH Casein kinase I isoform delta-like OS=Arabidopsis thaliana GN=At4g26100 PE=2 SV=2 6 309 2.0E-96
sp|Q20471|KIN20_CAEEL Casein kinase I isoform delta OS=Caenorhabditis elegans GN=kin-20 PE=2 SV=3 3 288 7.0E-96
sp|P40236|HHP2_SCHPO Casein kinase I homolog hhp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hhp2 PE=2 SV=2 3 290 3.0E-95
sp|P35507|KC1B_BOVIN Casein kinase I isoform beta OS=Bos taurus GN=CSNK1B PE=2 SV=1 3 310 5.0E-95
sp|P42168|KC1A_CAEEL Casein kinase I isoform alpha OS=Caenorhabditis elegans GN=kin-19 PE=3 SV=1 1 293 2.0E-94
sp|Q7RBX5|KC1_PLAYO Casein kinase I OS=Plasmodium yoelii yoelii GN=CK1 PE=3 SV=1 3 284 5.0E-93
sp|Q8IHZ9|KC1_PLAF7 Casein kinase I OS=Plasmodium falciparum (isolate 3D7) GN=CK1 PE=3 SV=1 3 284 5.0E-93
sp|O15726|KC1_PLAF4 Casein kinase I OS=Plasmodium falciparum (isolate Dd2) GN=CK1 PE=2 SV=1 3 284 6.0E-92
sp|Q8N752|KC1AL_HUMAN Casein kinase I isoform alpha-like OS=Homo sapiens GN=CSNK1A1L PE=2 SV=2 3 284 1.0E-91
sp|P29295|HRR25_YEAST Casein kinase I homolog HRR25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRR25 PE=1 SV=1 3 288 2.0E-91
sp|P54367|KC1A_DROME Casein kinase I isoform alpha OS=Drosophila melanogaster GN=CkIalpha PE=1 SV=1 3 284 1.0E-89
sp|P40234|CKI2_SCHPO Casein kinase I homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cki2 PE=1 SV=2 5 283 6.0E-82
sp|O74135|CKI3_SCHPO Casein kinase I homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cki3 PE=3 SV=1 5 284 3.0E-78
sp|Q5PRD4|KC1G1_DANRE Casein kinase I isoform gamma-1 OS=Danio rerio GN=csnk1g1 PE=2 SV=1 4 284 9.0E-78
sp|Q8C4X2|KC1G3_MOUSE Casein kinase I isoform gamma-3 OS=Mus musculus GN=Csnk1g3 PE=1 SV=2 4 288 7.0E-77
sp|Q4R9A9|KC1G1_MACFA Casein kinase I isoform gamma-1 OS=Macaca fascicularis GN=CSNK1G1 PE=2 SV=1 4 284 8.0E-77
sp|Q9HCP0|KC1G1_HUMAN Casein kinase I isoform gamma-1 OS=Homo sapiens GN=CSNK1G1 PE=1 SV=1 4 284 2.0E-76
sp|Q62763|KC1G3_RAT Casein kinase I isoform gamma-3 OS=Rattus norvegicus GN=Csnk1g3 PE=1 SV=1 4 288 2.0E-76
sp|A7E3X2|KC1G1_BOVIN Casein kinase I isoform gamma-1 OS=Bos taurus GN=CSNK1G1 PE=2 SV=1 4 283 5.0E-76
sp|Q8BTH8|KC1G1_MOUSE Casein kinase I isoform gamma-1 OS=Mus musculus GN=Csnk1g1 PE=1 SV=2 4 283 7.0E-76
sp|Q6NRT0|KC1G1_XENLA Casein kinase I isoform gamma-1 OS=Xenopus laevis GN=csnk1g1 PE=1 SV=1 4 284 7.0E-76
sp|P40233|CKI1_SCHPO Casein kinase I homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cki1 PE=1 SV=2 5 283 9.0E-76
sp|Q62761|KC1G1_RAT Casein kinase I isoform gamma-1 OS=Rattus norvegicus GN=Csnk1g1 PE=2 SV=1 4 284 1.0E-75
sp|Q5R4V3|KC1G3_PONAB Casein kinase I isoform gamma-3 OS=Pongo abelii GN=CSNK1G3 PE=2 SV=1 4 288 2.0E-75
sp|P78368|KC1G2_HUMAN Casein kinase I isoform gamma-2 OS=Homo sapiens GN=CSNK1G2 PE=1 SV=1 4 313 3.0E-75
sp|Q5ZJS0|KC1G1_CHICK Casein kinase I isoform gamma-1 OS=Gallus gallus GN=CSNK1G1 PE=2 SV=1 4 284 3.0E-75
sp|Q9Y6M4|KC1G3_HUMAN Casein kinase I isoform gamma-3 OS=Homo sapiens GN=CSNK1G3 PE=1 SV=2 4 288 1.0E-74
sp|Q62762|KC1G2_RAT Casein kinase I isoform gamma-2 OS=Rattus norvegicus GN=Csnk1g2 PE=2 SV=2 4 286 5.0E-74
sp|Q8BVP5|KC1G2_MOUSE Casein kinase I isoform gamma-2 OS=Mus musculus GN=Csnk1g2 PE=1 SV=1 4 286 6.0E-74
sp|Q8WQ99|KC1G_CAEEL Casein kinase I gamma OS=Caenorhabditis elegans GN=csnk-1 PE=3 SV=1 4 286 2.0E-71
sp|P40230|RAG8_KLULA Casein kinase I homolog RAG8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG8 PE=3 SV=2 5 285 4.0E-69
sp|P23292|KC12_YEAST Casein kinase I homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCK2 PE=1 SV=1 4 283 7.0E-66
sp|P35509|KC1G3_BOVIN Casein kinase I isoform gamma-3 (Fragment) OS=Bos taurus GN=CSNK1G3 PE=2 SV=1 4 248 6.0E-65
sp|P23291|KC11_YEAST Casein kinase I homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCK1 PE=1 SV=1 4 285 7.0E-65
sp|Q8SS96|KC11_ENCCU Probable casein kinase I homolog ECU03_0910 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU03_0910 PE=3 SV=2 15 283 5.0E-64
sp|P39962|KC13_YEAST Casein kinase I homolog 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCK3 PE=1 SV=2 5 285 3.0E-62
sp|Q54DF7|Y2354_DICDI Probable serine/threonine-protein kinase DDB_G0292354 OS=Dictyostelium discoideum GN=DDB_G0292354 PE=3 SV=1 5 283 8.0E-49
sp|O19175|KC1A_PIG Casein kinase I isoform alpha (Fragment) OS=Sus scrofa GN=CSNK1A1 PE=2 SV=1 33 157 1.0E-45
sp|Q6PCN3|TTBK1_MOUSE Tau-tubulin kinase 1 OS=Mus musculus GN=Ttbk1 PE=1 SV=3 5 283 3.0E-43
sp|Q5TCY1|TTBK1_HUMAN Tau-tubulin kinase 1 OS=Homo sapiens GN=TTBK1 PE=1 SV=2 5 283 5.0E-43
sp|Q3UVR3|TTBK2_MOUSE Tau-tubulin kinase 2 OS=Mus musculus GN=Ttbk2 PE=1 SV=1 4 283 2.0E-41
sp|Q6IQ55|TTBK2_HUMAN Tau-tubulin kinase 2 OS=Homo sapiens GN=TTBK2 PE=1 SV=2 4 283 7.0E-41
sp|Q8SQR2|KC12_ENCCU Probable casein kinase I homolog ECU11_1980 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1980 PE=3 SV=1 10 302 4.0E-39
sp|Q95PZ9|SPE6_CAEEL Probable serine/threonine-protein kinase spe-6 OS=Caenorhabditis elegans GN=spe-6 PE=1 SV=1 9 283 2.0E-29
sp|P34516|YMX8_CAEEL Putative serine/threonine-protein kinase K06H7.1 OS=Caenorhabditis elegans GN=K06H7.8 PE=3 SV=2 5 287 5.0E-27
sp|Q91FD5|389L_IIV6 Probable serine/threonine-protein kinase 389L OS=Invertebrate iridescent virus 6 GN=IIV6-389L PE=3 SV=1 5 267 2.0E-23
sp|Q99986|VRK1_HUMAN Serine/threonine-protein kinase VRK1 OS=Homo sapiens GN=VRK1 PE=1 SV=1 5 284 2.0E-22
sp|P42169|YKL2_CAEEL Putative casein kinase I C03C10.2 OS=Caenorhabditis elegans GN=C03C10.2 PE=3 SV=2 5 208 3.0E-22
sp|Q32PI1|VRK1_BOVIN Serine/threonine-protein kinase VRK1 OS=Bos taurus GN=VRK1 PE=2 SV=1 16 284 2.0E-21
sp|Q80X41|VRK1_MOUSE Serine/threonine-protein kinase VRK1 OS=Mus musculus GN=Vrk1 PE=1 SV=2 16 284 2.0E-21
sp|P33800|VPK1_VAR67 Serine/threonine-protein kinase 1 OS=Variola virus (isolate Human/India/Ind3/1967) GN=B1R PE=3 SV=1 16 266 4.0E-21
sp|Q7ZUS1|VRK1_DANRE Serine/threonine-protein kinase VRK1 OS=Danio rerio GN=vrk1 PE=2 SV=1 9 283 6.0E-21
sp|P16913|VPK1_VACCW Serine/threonine-protein kinase 1 OS=Vaccinia virus (strain Western Reserve) GN=VPK1 PE=1 SV=1 16 266 8.0E-21
sp|O57252|VPK1_VACCA Serine/threonine-protein kinase 1 OS=Vaccinia virus (strain Ankara) GN=VPK1 PE=3 SV=1 16 266 9.0E-21
sp|P20505|VPK1_VACCC Serine/threonine-protein kinase 1 OS=Vaccinia virus (strain Copenhagen) GN=VPK1 PE=2 SV=1 16 266 1.0E-20
sp|P81123|KC1D_RABIT Casein kinase I isoform delta (Fragment) OS=Oryctolagus cuniculus GN=CSNK1D PE=1 SV=1 130 200 2.0E-18
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 10 209 2.0E-17
sp|A8WU31|VRK1_CAEBR Serine/threonine-protein kinase VRK1 OS=Caenorhabditis briggsae GN=vrk-1 PE=3 SV=1 3 207 6.0E-17
sp|Q9J523|V212_FOWPN Probable serine/threonine-protein kinase FPV212 OS=Fowlpox virus (strain NVSL) GN=FPV212 PE=3 SV=1 5 266 9.0E-17
sp|O57259|KRB2_VACCA Probable serine/threonine-protein kinase B12 OS=Vaccinia virus (strain Ankara) GN=MVA180R PE=3 SV=1 64 266 1.0E-16
sp|P21098|KRB2_VACCC Probable serine/threonine-protein kinase B12 OS=Vaccinia virus (strain Copenhagen) GN=B12R PE=3 SV=1 64 266 1.0E-16
sp|Q9J509|V226_FOWPN Probable serine/threonine-protein kinase FPV226 OS=Fowlpox virus (strain NVSL) GN=FPV226 PE=3 SV=1 5 269 2.0E-16
sp|O31435|YBDM_BACSU Probable serine/threonine-protein kinase YbdM OS=Bacillus subtilis (strain 168) GN=ybdM PE=1 SV=1 4 241 2.0E-16
sp|Q8BN21|VRK2_MOUSE Serine/threonine-protein kinase VRK2 OS=Mus musculus GN=Vrk2 PE=1 SV=2 3 267 3.0E-16
sp|A6QGC0|PRKC_STAAE Serine/threonine-protein kinase PrkC OS=Staphylococcus aureus (strain Newman) GN=prkC PE=1 SV=1 5 209 3.0E-16
sp|Q86Y07|VRK2_HUMAN Serine/threonine-protein kinase VRK2 OS=Homo sapiens GN=VRK2 PE=1 SV=3 15 267 3.0E-16
sp|Q09503|YQI1_CAEEL Uncharacterized protein C45G9.1 OS=Caenorhabditis elegans GN=C45G9.1 PE=3 SV=2 66 307 6.0E-16
sp|Q7KRY6|NHK1_DROME Nucleosomal histone kinase 1 OS=Drosophila melanogaster GN=ball PE=1 SV=1 5 286 8.0E-16
sp|P24362|KRB2_VACCW Probable serine/threonine-protein kinase B12 OS=Vaccinia virus (strain Western Reserve) GN=VACWR194 PE=2 SV=1 64 266 1.0E-15
sp|Q19848|VRK1_CAEEL Serine/threonine-protein kinase VRK1 OS=Caenorhabditis elegans GN=vrk-1 PE=1 SV=1 5 209 3.0E-15
sp|P34633|YOO1_CAEEL Putative serine/threonine-protein kinase ZK507.1 OS=Caenorhabditis elegans GN=ZK507.1 PE=3 SV=3 68 226 2.0E-14
sp|P54736|PKN2_MYXXA Serine/threonine-protein kinase pkn2 OS=Myxococcus xanthus GN=pkn2 PE=3 SV=1 4 212 2.0E-14
sp|Q9KIG4|PK1_STRTO Serine/threonine-protein kinase PK-1 OS=Streptomyces toyocaensis GN=spk1 PE=1 SV=1 5 213 4.0E-14
sp|P54741|AFSK_STRCO Serine/threonine-protein kinase AfsK OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=afsK PE=1 SV=2 8 287 5.0E-14
sp|O34507|PRKC_BACSU Serine/threonine-protein kinase PrkC OS=Bacillus subtilis (strain 168) GN=prkC PE=1 SV=1 6 210 6.0E-14
sp|P34635|YOO3_CAEEL Putative serine/threonine-protein kinase ZK507.3 OS=Caenorhabditis elegans GN=ZK507.3 PE=3 SV=3 10 226 1.0E-13
sp|Q8G4G1|PKNA2_BIFLO Probable serine/threonine-protein kinase pknA2 OS=Bifidobacterium longum (strain NCC 2705) GN=pknA2 PE=3 SV=1 5 271 1.0E-13
sp|Q8R9T6|PKN1_CALS4 Probable serine/threonine-protein kinase Sps1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=sps1 PE=3 SV=1 8 212 2.0E-13
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 3 214 2.0E-13
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 1 226 2.0E-13
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 3 214 2.0E-13
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 3 214 2.0E-13
sp|Q9Y7J6|PPK21_SCHPO Serine/threonine-protein kinase ppk21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk21 PE=1 SV=3 16 265 5.0E-13
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 2 209 6.0E-13
sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=3 SV=1 9 225 1.0E-12
sp|Q54CY9|MYLKD_DICDI Probable myosin light chain kinase DDB_G0292624 OS=Dictyostelium discoideum GN=DDB_G0292624 PE=3 SV=1 8 206 1.0E-12
sp|Q8XJL8|PKN2_CLOPE Probable serine/threonine-protein kinase CPE1738 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE1738 PE=3 SV=1 5 213 2.0E-12
sp|Q556S2|PAKH_DICDI Serine/threonine-protein kinase pakH OS=Dictyostelium discoideum GN=pakH-1 PE=3 SV=1 10 212 2.0E-12
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 1 209 2.0E-12
sp|P9WI83|PKNA_MYCTU Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknA PE=1 SV=1 4 209 3.0E-12
sp|P9WI82|PKNA_MYCTO Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknA PE=3 SV=1 4 209 3.0E-12
sp|A5TY85|PKNA_MYCTA Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pknA PE=1 SV=1 4 209 3.0E-12
sp|P65727|PKNA_MYCBO Serine/threonine-protein kinase PknA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknA PE=3 SV=1 4 209 3.0E-12
sp|Q1PE17|CDPKI_ARATH Calcium-dependent protein kinase 18 OS=Arabidopsis thaliana GN=CPK18 PE=2 SV=1 7 154 3.0E-12
sp|O80673|CAMK1_ARATH CDPK-related kinase 1 OS=Arabidopsis thaliana GN=CRK1 PE=1 SV=1 10 210 3.0E-12
sp|P54742|AFSK_STRGR Serine/threonine-protein kinase AfsK OS=Streptomyces griseus GN=afsK PE=3 SV=1 8 214 3.0E-12
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 2 207 3.0E-12
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 1 209 4.0E-12
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 1 213 5.0E-12
sp|P54743|PKNA_MYCLE Serine/threonine-protein kinase PknA OS=Mycobacterium leprae (strain TN) GN=pknA PE=3 SV=3 4 209 6.0E-12
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 9 226 7.0E-12
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 9 226 7.0E-12
sp|Q9LET1|CAMK7_ARATH CDPK-related kinase 7 OS=Arabidopsis thaliana GN=CRK7 PE=1 SV=1 10 154 1.0E-11
sp|P32491|MKK2_YEAST MAP kinase kinase MKK2/SSP33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKK2 PE=1 SV=2 76 258 1.0E-11
sp|P54735|SPKD_SYNY3 Serine/threonine-protein kinase D OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=spkD PE=1 SV=1 3 208 1.0E-11
sp|O35099|M3K5_MOUSE Mitogen-activated protein kinase kinase kinase 5 OS=Mus musculus GN=Map3k5 PE=1 SV=3 16 207 2.0E-11
sp|Q255D2|PKND_CHLFF Serine/threonine-protein kinase PknD OS=Chlamydophila felis (strain Fe/C-56) GN=pknD PE=3 SV=2 9 211 2.0E-11
sp|Q9CEF5|PKNB_LACLA Probable serine/threonine-protein kinase PknB OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pknB PE=3 SV=1 9 209 2.0E-11
sp|Q9YHZ5|PIM2_DANRE Serine/threonine-protein kinase pim-2 OS=Danio rerio GN=pim2 PE=2 SV=2 9 208 2.0E-11
sp|P41279|M3K8_HUMAN Mitogen-activated protein kinase kinase kinase 8 OS=Homo sapiens GN=MAP3K8 PE=1 SV=2 7 212 2.0E-11
sp|Q99683|M3K5_HUMAN Mitogen-activated protein kinase kinase kinase 5 OS=Homo sapiens GN=MAP3K5 PE=1 SV=1 16 207 2.0E-11
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 10 207 3.0E-11
sp|Q9FKW4|CDPKS_ARATH Calcium-dependent protein kinase 28 OS=Arabidopsis thaliana GN=CPK28 PE=1 SV=1 10 225 3.0E-11
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 5 290 3.0E-11
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 2 213 3.0E-11
sp|O61267|LOK_DROME Ovarian-specific serine/threonine-protein kinase Lok OS=Drosophila melanogaster GN=lok PE=2 SV=1 6 207 4.0E-11
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 9 207 4.0E-11
sp|B3NE99|PLK4_DROER Serine/threonine-protein kinase PLK4 OS=Drosophila erecta GN=SAK PE=3 SV=1 10 208 4.0E-11
sp|Q8KY50|STKP1_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 5 209 4.0E-11
sp|B4PDM5|PLK4_DROYA Serine/threonine-protein kinase PLK4 OS=Drosophila yakuba GN=SAK PE=3 SV=1 10 208 4.0E-11
sp|Q97PA9|STKP2_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 5 209 4.0E-11
sp|Q822K5|PKND_CHLCV Serine/threonine-protein kinase PknD OS=Chlamydophila caviae (strain GPIC) GN=pknD PE=3 SV=1 9 211 5.0E-11
sp|Q8DNS0|STKP_STRR6 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=stkP PE=1 SV=1 5 209 5.0E-11
sp|Q04J43|STKP_STRP2 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=stkP PE=1 SV=1 5 209 5.0E-11
sp|Q97IC2|PKN2_CLOAB Probable serine/threonine-protein kinase CA_C1728 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1728 PE=3 SV=1 5 213 5.0E-11
sp|Q6ERS0|CIPKR_ORYSJ Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1 5 234 5.0E-11
sp|B3M6I4|PLK4_DROAN Serine/threonine-protein kinase PLK4 OS=Drosophila ananassae GN=SAK PE=3 SV=1 10 208 6.0E-11
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 10 248 6.0E-11
sp|P74745|SPKC_SYNY3 Serine/threonine-protein kinase C OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=spkC PE=1 SV=1 5 206 7.0E-11
sp|Q8NU97|PKN2_CORGL Serine/threonine-protein kinases PknA OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pknA PE=3 SV=1 5 209 7.0E-11
sp|Q63562|M3K8_RAT Mitogen-activated protein kinase kinase kinase 8 OS=Rattus norvegicus GN=Map3k8 PE=1 SV=1 7 212 8.0E-11
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 1 207 8.0E-11
sp|Q5L5J7|PKND_CHLAB Serine/threonine-protein kinase PknD OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=pknD PE=3 SV=1 10 258 9.0E-11
sp|B4IAQ8|PLK4_DROSE Serine/threonine-protein kinase PLK4 OS=Drosophila sechellia GN=SAK PE=3 SV=1 10 208 9.0E-11
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 8 207 1.0E-10
sp|P32490|MKK1_YEAST MAP kinase kinase MKK1/SSP32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKK1 PE=1 SV=1 75 222 1.0E-10
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 8 207 1.0E-10
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 9 207 1.0E-10
sp|Q8FUI5|PKN1_COREF Probable serine/threonine-protein kinase CE0033 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=CE0033 PE=3 SV=1 5 212 1.0E-10
sp|P28582|CDPK_DAUCA Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2 6 154 1.0E-10
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 9 207 1.0E-10
sp|B4QK53|PLK4_DROSI Serine/threonine-protein kinase PLK4 OS=Drosophila simulans GN=SAK PE=3 SV=1 10 208 1.0E-10
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 16 212 1.0E-10
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 8 207 1.0E-10
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 5 289 1.0E-10
sp|Q07174|M3K8_MOUSE Mitogen-activated protein kinase kinase kinase 8 OS=Mus musculus GN=Map3k8 PE=1 SV=1 7 212 2.0E-10
sp|P9WI79|PKND_MYCTU Serine/threonine-protein kinase PknD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknD PE=1 SV=1 8 257 2.0E-10
sp|P9WI78|PKND_MYCTO Serine/threonine-protein kinase PknD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknD PE=1 SV=1 8 257 2.0E-10
sp|Q26671|CDC2H_THEAN Cell division control protein 2 homolog OS=Theileria annulata GN=CRK2 PE=2 SV=1 9 158 2.0E-10
sp|O97143|PLK4_DROME Serine/threonine-protein kinase PLK4 OS=Drosophila melanogaster GN=SAK PE=1 SV=1 10 208 2.0E-10
sp|Q27032|CDC2H_THEPA Cell division control protein 2 homolog OS=Theileria parva GN=CRK2 PE=3 SV=1 9 158 2.0E-10
sp|Q10KY3|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threonine-protein kinase 1 OS=Oryza sativa subsp. japonica GN=CAMK1 PE=1 SV=1 8 210 2.0E-10
sp|Q9N0P9|PIM1_BOVIN Serine/threonine-protein kinase pim-1 OS=Bos taurus GN=PIM1 PE=2 SV=1 6 208 2.0E-10
sp|Q9Z986|PKND_CHLPN Serine/threonine-protein kinase PknD OS=Chlamydia pneumoniae GN=pknD PE=3 SV=2 9 211 2.0E-10
sp|Q8IWQ3|BRSK2_HUMAN Serine/threonine-protein kinase BRSK2 OS=Homo sapiens GN=BRSK2 PE=1 SV=3 8 207 2.0E-10
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 8 207 2.0E-10
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 10 207 2.0E-10
sp|Q2QYM3|CIPKE_ORYSJ CBL-interacting protein kinase 14 OS=Oryza sativa subsp. japonica GN=CIPK14 PE=2 SV=1 5 209 3.0E-10
sp|Q6ZN16|M3K15_HUMAN Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens GN=MAP3K15 PE=1 SV=2 16 208 3.0E-10
sp|Q69Z98|BRSK2_MOUSE Serine/threonine-protein kinase BRSK2 OS=Mus musculus GN=Brsk2 PE=1 SV=2 8 207 3.0E-10
sp|Q9XBQ0|PKN3_MYXXA Serine/threonine-protein kinase pkn3 OS=Myxococcus xanthus GN=pkn3 PE=3 SV=1 9 208 3.0E-10
sp|Q2YDN8|VRK3_BOVIN Inactive serine/threonine-protein kinase VRK3 OS=Bos taurus GN=VRK3 PE=2 SV=1 64 263 4.0E-10
sp|O01775|NEKL2_CAEEL Serine/threonine-protein kinase nekl-2 OS=Caenorhabditis elegans GN=nekl-2 PE=2 SV=1 16 262 4.0E-10
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 5 209 4.0E-10
sp|D3ZML2|BRSK2_RAT Serine/threonine-protein kinase BRSK2 OS=Rattus norvegicus GN=Brsk2 PE=1 SV=1 8 207 4.0E-10
sp|Q17850|PK1_CAEEL Serine/threonine-protein kinase pak-1 OS=Caenorhabditis elegans GN=pak-1 PE=1 SV=2 9 212 4.0E-10
sp|Q9PK92|PKND_CHLMU Serine/threonine-protein kinase PknD OS=Chlamydia muridarum (strain MoPn / Nigg) GN=pknD PE=3 SV=1 9 227 5.0E-10
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 5 210 5.0E-10
sp|A8XQD5|DKF2_CAEBR Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis briggsae GN=dkf-2 PE=3 SV=2 16 207 5.0E-10
sp|Q9XA16|PKNX_STRCO Probable serine/threonine-protein kinase SCO3848 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3848 PE=3 SV=1 8 212 6.0E-10
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 15 212 6.0E-10
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 15 212 6.0E-10
sp|Q9SCS2|CAMK5_ARATH CDPK-related kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=2 SV=1 8 210 6.0E-10
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 10 218 6.0E-10
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 15 212 6.0E-10
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 15 212 7.0E-10
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 8 208 7.0E-10
sp|Q9FIM9|CAMK4_ARATH CDPK-related kinase 4 OS=Arabidopsis thaliana GN=CRK4 PE=2 SV=1 8 210 8.0E-10
sp|Q7PLI7|DCLK_DROME Serine/threonine-protein kinase CG17528 OS=Drosophila melanogaster GN=CG17528 PE=1 SV=1 6 175 8.0E-10
sp|P26794|PIM1_RAT Serine/threonine-protein kinase pim-1 OS=Rattus norvegicus GN=Pim1 PE=1 SV=1 6 263 8.0E-10
sp|Q95LJ0|PIM1_FELCA Serine/threonine-protein kinase pim-1 OS=Felis catus GN=PIM1 PE=2 SV=1 6 208 8.0E-10
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 5 277 8.0E-10
sp|Q8SRL5|IPL1_ENCCU Probable spindle assembly checkpoint kinase homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=IPL1 PE=3 SV=1 9 210 8.0E-10
sp|Q42438|CDPK8_ARATH Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 10 157 9.0E-10
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 5 207 9.0E-10
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 6 154 9.0E-10
sp|B3NKK1|DCLK_DROER Serine/threonine-protein kinase GG21441 OS=Drosophila erecta GN=GG21441 PE=3 SV=1 6 175 1.0E-09
sp|Q9Z265|CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus GN=Chek2 PE=1 SV=1 10 211 1.0E-09
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 16 209 1.0E-09
sp|O45818|DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans GN=dkf-2 PE=1 SV=4 16 207 1.0E-09
sp|A2AQW0|M3K15_MOUSE Mitogen-activated protein kinase kinase kinase 15 OS=Mus musculus GN=Map3k15 PE=1 SV=1 16 207 1.0E-09
sp|P06803|PIM1_MOUSE Serine/threonine-protein kinase pim-1 OS=Mus musculus GN=Pim1 PE=1 SV=2 6 263 1.0E-09
sp|P11309|PIM1_HUMAN Serine/threonine-protein kinase pim-1 OS=Homo sapiens GN=PIM1 PE=1 SV=3 6 208 1.0E-09
sp|Q09437|YP62_CAEEL Putative serine/threonine-protein kinase B0495.2 OS=Caenorhabditis elegans GN=B0495.2 PE=3 SV=1 10 276 1.0E-09
sp|A2BD05|NEK6_PIG Serine/threonine-protein kinase Nek6 OS=Sus scrofa GN=NEK6 PE=3 SV=1 10 211 2.0E-09
sp|Q9NJU9|CDPK3_PLAF7 Calcium-dependent protein kinase 3 OS=Plasmodium falciparum (isolate 3D7) GN=CPK3 PE=1 SV=1 16 249 2.0E-09
sp|P59895|NEK6_RAT Serine/threonine-protein kinase Nek6 OS=Rattus norvegicus GN=Nek6 PE=1 SV=1 10 211 2.0E-09
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 10 207 2.0E-09
sp|Q8K1Y2|KPCD3_MOUSE Serine/threonine-protein kinase D3 OS=Mus musculus GN=Prkd3 PE=1 SV=1 2 207 2.0E-09
sp|B4IT27|DCLK_DROYA Serine/threonine-protein kinase GE16371 OS=Drosophila yakuba GN=GE16371 PE=3 SV=2 6 175 2.0E-09
sp|Q9ES70|NEK6_MOUSE Serine/threonine-protein kinase Nek6 OS=Mus musculus GN=Nek6 PE=1 SV=1 10 211 2.0E-09
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 10 207 2.0E-09
sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK2 PE=1 SV=2 16 207 2.0E-09
sp|O94806|KPCD3_HUMAN Serine/threonine-protein kinase D3 OS=Homo sapiens GN=PRKD3 PE=1 SV=1 2 207 2.0E-09
sp|Q9HC98|NEK6_HUMAN Serine/threonine-protein kinase Nek6 OS=Homo sapiens GN=NEK6 PE=1 SV=2 10 211 2.0E-09
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 5 207 2.0E-09
sp|P54734|PKNA_NOSS1 Serine/threonine-protein kinase PknA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=pknA PE=3 SV=2 5 206 2.0E-09
sp|Q8FUI4|PKN2_COREF Serine/threonine-protein kinases drp72 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=CE0034 PE=3 SV=1 10 209 2.0E-09
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 5 208 3.0E-09
sp|O70444|PIM3_RAT Serine/threonine-protein kinase pim-3 OS=Rattus norvegicus GN=Pim3 PE=1 SV=3 10 208 3.0E-09
sp|Q6DGS3|KC2D2_DANRE Calcium/calmodulin-dependent protein kinase type II delta 2 chain OS=Danio rerio GN=camk2d2 PE=2 SV=2 10 175 3.0E-09
sp|A8WXF6|KCC2D_CAEBR Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis briggsae GN=unc-43 PE=3 SV=1 10 207 3.0E-09
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 7 207 3.0E-09
sp|P58750|PIM3_MOUSE Serine/threonine-protein kinase pim-3 OS=Mus musculus GN=Pim3 PE=1 SV=1 10 208 3.0E-09
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 9 212 3.0E-09
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 3 280 3.0E-09
sp|Q5XIS9|KPCD2_RAT Serine/threonine-protein kinase D2 OS=Rattus norvegicus GN=Prkd2 PE=1 SV=1 13 207 3.0E-09
sp|Q5R4L1|PLK2_PONAB Serine/threonine-protein kinase PLK2 OS=Pongo abelii GN=PLK2 PE=3 SV=1 3 280 3.0E-09
sp|Q8K3G5|VRK3_MOUSE Inactive serine/threonine-protein kinase VRK3 OS=Mus musculus GN=Vrk3 PE=1 SV=2 64 263 3.0E-09
sp|Q54QD5|NEK1_DICDI Probable serine/threonine-protein kinase nek1 OS=Dictyostelium discoideum GN=nek1 PE=3 SV=1 9 211 3.0E-09
sp|Q9LQQ8|RLCK7_ARATH Probable serine/threonine-protein kinase RLCKVII OS=Arabidopsis thaliana GN=At1g07870 PE=2 SV=1 6 203 3.0E-09
sp|P53351|PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus GN=Plk2 PE=1 SV=1 3 280 3.0E-09
sp|Q8BZ03|KPCD2_MOUSE Serine/threonine-protein kinase D2 OS=Mus musculus GN=Prkd2 PE=1 SV=1 13 207 3.0E-09
sp|B4IMC3|DCLK_DROSE Serine/threonine-protein kinase GM11705 OS=Drosophila sechellia GN=GM11705 PE=3 SV=1 6 175 4.0E-09
sp|Q7RAV5|CDPK3_PLAYO Calcium-dependent protein kinase 3 OS=Plasmodium yoelii yoelii GN=CPK3 PE=3 SV=1 16 226 4.0E-09
sp|Q9BZL6|KPCD2_HUMAN Serine/threonine-protein kinase D2 OS=Homo sapiens GN=PRKD2 PE=1 SV=2 13 207 4.0E-09
sp|O62305|KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans GN=unc-43 PE=1 SV=2 10 207 4.0E-09
sp|Q9SJ61|CDPKP_ARATH Calcium-dependent protein kinase 25 OS=Arabidopsis thaliana GN=CPK25 PE=2 SV=1 10 209 4.0E-09
sp|B4NSS9|DCLK_DROSI Serine/threonine-protein kinase GD17699 OS=Drosophila simulans GN=GD17699 PE=3 SV=1 6 175 4.0E-09
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 8 209 4.0E-09
sp|Q9LJL9|CAMK2_ARATH CDPK-related kinase 2 OS=Arabidopsis thaliana GN=CRK2 PE=1 SV=1 6 154 4.0E-09
sp|Q9NYY3|PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens GN=PLK2 PE=1 SV=3 3 280 4.0E-09
sp|Q5ZKI0|KCC2D_CHICK Calcium/calmodulin-dependent protein kinase type II delta chain OS=Gallus gallus GN=CAMK2D PE=2 SV=1 10 175 4.0E-09
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 5 210 4.0E-09
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 8 209 4.0E-09
sp|Q86V86|PIM3_HUMAN Serine/threonine-protein kinase pim-3 OS=Homo sapiens GN=PIM3 PE=1 SV=3 10 208 4.0E-09
sp|Q38871|CDPK5_ARATH Calcium-dependent protein kinase 5 OS=Arabidopsis thaliana GN=CPK5 PE=2 SV=1 10 157 5.0E-09
sp|Q00168|KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain OS=Drosophila melanogaster GN=CaMKII PE=1 SV=1 10 207 5.0E-09
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 8 209 5.0E-09
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 16 207 5.0E-09
sp|B4LDJ6|PLK4_DROVI Serine/threonine-protein kinase PLK4 OS=Drosophila virilis GN=SAK PE=3 SV=1 10 207 5.0E-09
sp|Q55GV3|PAKC_DICDI Serine/threonine-protein kinase pakC OS=Dictyostelium discoideum GN=pakC PE=1 SV=2 10 212 5.0E-09
sp|Q8G6P9|PKNB_BIFLO Probable serine/threonine-protein kinase PknB OS=Bifidobacterium longum (strain NCC 2705) GN=pknB PE=3 SV=1 1 209 5.0E-09
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 8 208 5.0E-09
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 8 208 6.0E-09
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 10 224 6.0E-09
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 9 207 6.0E-09
sp|P49101|CDPK2_MAIZE Calcium-dependent protein kinase 2 OS=Zea mays GN=CPK2 PE=2 SV=1 6 154 6.0E-09
sp|Q9SG12|CAMK6_ARATH CDPK-related kinase 6 OS=Arabidopsis thaliana GN=CRK6 PE=1 SV=1 8 210 6.0E-09
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 16 175 6.0E-09
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 8 212 6.0E-09
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 8 218 7.0E-09
sp|Q9H4B4|PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens GN=PLK3 PE=1 SV=2 16 280 7.0E-09
sp|Q62101|KPCD1_MOUSE Serine/threonine-protein kinase D1 OS=Mus musculus GN=Prkd1 PE=1 SV=2 2 207 7.0E-09
sp|Q9P1W9|PIM2_HUMAN Serine/threonine-protein kinase pim-2 OS=Homo sapiens GN=PIM2 PE=1 SV=1 7 208 7.0E-09
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 8 210 7.0E-09
sp|Q9WTQ1|KPCD1_RAT Serine/threonine-protein kinase D1 OS=Rattus norvegicus GN=Prkd1 PE=1 SV=2 2 207 7.0E-09
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 8 208 7.0E-09
sp|Q60806|PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus GN=Plk3 PE=1 SV=2 16 280 8.0E-09
sp|Q8SSH1|Y255_ENCCU Probable serine/threonine-protein kinase ECU02_0550 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU02_0550 PE=3 SV=1 9 198 8.0E-09
sp|Q5RCC4|KCC2A_PONAB Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Pongo abelii GN=CAMK2A PE=2 SV=2 10 207 8.0E-09
sp|Q9UQM7|KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Homo sapiens GN=CAMK2A PE=1 SV=2 10 207 8.0E-09
sp|P11275|KCC2A_RAT Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Rattus norvegicus GN=Camk2a PE=1 SV=1 10 207 8.0E-09
sp|P11798|KCC2A_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus GN=Camk2a PE=1 SV=2 10 207 8.0E-09
sp|Q15139|KPCD1_HUMAN Serine/threonine-protein kinase D1 OS=Homo sapiens GN=PRKD1 PE=1 SV=2 2 207 8.0E-09
sp|Q38872|CDPK6_ARATH Calcium-dependent protein kinase 6 OS=Arabidopsis thaliana GN=CPK6 PE=1 SV=1 10 157 8.0E-09
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 8 207 8.0E-09
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 8 210 8.0E-09
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 8 208 8.0E-09
sp|Q2HJF7|KCC2D_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Bos taurus GN=CAMK2D PE=2 SV=1 10 175 9.0E-09
sp|Q6PHZ2|KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus GN=Camk2d PE=1 SV=1 10 175 9.0E-09
sp|Q13557|KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens GN=CAMK2D PE=1 SV=3 10 175 9.0E-09
sp|B5DK35|DCLK_DROPS Serine/threonine-protein kinase GA29083 OS=Drosophila pseudoobscura pseudoobscura GN=GA29083 PE=3 SV=1 6 175 1.0E-08
sp|Q95266|KCC2D_PIG Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Sus scrofa GN=CAMK2D PE=2 SV=1 10 175 1.0E-08
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 6 157 1.0E-08
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 16 227 1.0E-08
sp|B4GXC2|DCLK_DROPE Serine/threonine-protein kinase GL21140 OS=Drosophila persimilis GN=GL21140 PE=3 SV=1 6 175 1.0E-08
sp|P34117|CDK5_DICDI Cyclin-dependent kinase 5 homolog OS=Dictyostelium discoideum GN=cdk5 PE=2 SV=2 9 157 1.0E-08
sp|P15791|KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus GN=Camk2d PE=1 SV=1 10 175 1.0E-08
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 8 208 1.0E-08
sp|O14047|PPK11_SCHPO Serine/threonine-protein kinase ppk11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk11 PE=3 SV=1 9 212 1.0E-08
sp|O77708|KCC2D_RABIT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Oryctolagus cuniculus GN=CAMK2D PE=2 SV=2 10 175 1.0E-08
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 10 207 1.0E-08
sp|Q8IV63|VRK3_HUMAN Inactive serine/threonine-protein kinase VRK3 OS=Homo sapiens GN=VRK3 PE=1 SV=2 64 263 1.0E-08
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 8 218 1.0E-08
sp|Q5R7I7|CDK20_PONAB Cyclin-dependent kinase 20 OS=Pongo abelii GN=CDK20 PE=2 SV=1 9 173 1.0E-08
sp|Q75DK7|STE20_ASHGO Serine/threonine-protein kinase STE20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STE20 PE=3 SV=2 10 212 1.0E-08
sp|P38973|CC2H1_TRYBB Cell division control protein 2 homolog 1 OS=Trypanosoma brucei brucei GN=CRK1 PE=3 SV=1 8 262 1.0E-08
sp|O75676|KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens GN=RPS6KA4 PE=1 SV=1 1 209 1.0E-08
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 9 207 2.0E-08
sp|Q1PFH8|CDPKJ_ARATH Calcium-dependent protein kinase 19 OS=Arabidopsis thaliana GN=CPK19 PE=2 SV=1 6 154 2.0E-08
sp|Q8W4I7|CDPKD_ARATH Calcium-dependent protein kinase 13 OS=Arabidopsis thaliana GN=CPK13 PE=1 SV=2 6 157 2.0E-08
sp|A4K2M3|STK4_PAPAN Serine/threonine-protein kinase 4 OS=Papio anubis GN=STK4 PE=3 SV=1 15 255 2.0E-08
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 10 207 2.0E-08
sp|P49673|KAPC_ASCSU cAMP-dependent protein kinase catalytic subunit OS=Ascaris suum GN=CAPK PE=2 SV=1 16 210 2.0E-08
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 5 208 2.0E-08
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 9 155 2.0E-08
sp|Q7U095|PKNH_MYCBO Serine/threonine-protein kinase PknH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknH PE=3 SV=1 8 257 2.0E-08
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 9 208 2.0E-08
sp|Q02595|KPK2_PLAFK Probable serine/threonine-protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=PK2 PE=2 SV=1 10 209 2.0E-08
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 8 210 2.0E-08
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 8 210 2.0E-08
sp|Q9FX86|CAMK8_ARATH CDPK-related kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=2 SV=1 7 154 2.0E-08
sp|O64483|SIRK_ARATH Senescence-induced receptor-like serine/threonine-protein kinase OS=Arabidopsis thaliana GN=SIRK PE=2 SV=1 5 203 2.0E-08
sp|P9WI71|PKNH_MYCTU Serine/threonine-protein kinase PknH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknH PE=1 SV=1 8 257 2.0E-08
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 8 210 2.0E-08
sp|A5A7I8|CDPK5_SOLTU Calcium-dependent protein kinase 5 OS=Solanum tuberosum GN=CPK5 PE=2 SV=1 10 157 2.0E-08
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 16 227 2.0E-08
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 1 212 2.0E-08
sp|P9WI70|PKNH_MYCTO Serine/threonine-protein kinase PknH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknH PE=3 SV=1 8 257 2.0E-08
sp|Q7TYY6|PKNL_MYCBO Serine/threonine-protein kinase PknL OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknL PE=3 SV=1 1 256 2.0E-08
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 9 212 3.0E-08
sp|Q9DG02|KCC2D_XENLA Calcium/calmodulin-dependent protein kinase type II delta chain OS=Xenopus laevis GN=camk2d PE=2 SV=1 10 175 3.0E-08
sp|Q3UIZ8|MYLK3_MOUSE Myosin light chain kinase 3 OS=Mus musculus GN=Mylk3 PE=1 SV=1 1 214 3.0E-08
sp|O95382|M3K6_HUMAN Mitogen-activated protein kinase kinase kinase 6 OS=Homo sapiens GN=MAP3K6 PE=1 SV=3 16 208 3.0E-08
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 16 227 3.0E-08
sp|Q9S2C0|PKSC_STRCO Serine/threonine-protein kinase PksC OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pksC PE=3 SV=1 5 212 3.0E-08
sp|Q03656|SKY1_YEAST Serine/threonine-protein kinase SKY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKY1 PE=1 SV=1 7 150 3.0E-08
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 8 210 3.0E-08
sp|Q9SZM3|CDPKQ_ARATH Calcium-dependent protein kinase 26 OS=Arabidopsis thaliana GN=CPK26 PE=2 SV=1 10 157 3.0E-08
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 1 212 3.0E-08
sp|O80902|CIPKM_ARATH CBL-interacting serine/threonine-protein kinase 22 OS=Arabidopsis thaliana GN=CIPK22 PE=2 SV=1 8 208 3.0E-08
sp|O94168|SNF1_CANTR Carbon catabolite-derepressing protein kinase OS=Candida tropicalis GN=SNF1 PE=3 SV=1 8 207 3.0E-08
sp|Q62070|PIM2_MOUSE Serine/threonine-protein kinase pim-2 OS=Mus musculus GN=Pim2 PE=1 SV=1 8 208 3.0E-08
sp|Q9WTR2|M3K6_MOUSE Mitogen-activated protein kinase kinase kinase 6 OS=Mus musculus GN=Map3k6 PE=1 SV=4 16 208 3.0E-08
sp|Q91822|PIM3_XENLA Serine/threonine-protein kinase pim-3 OS=Xenopus laevis GN=pim3 PE=1 SV=1 10 262 3.0E-08
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 1 212 3.0E-08
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 1 212 3.0E-08
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 1 212 3.0E-08
sp|P51566|AFC1_ARATH Serine/threonine-protein kinase AFC1 OS=Arabidopsis thaliana GN=AFC1 PE=2 SV=2 6 140 4.0E-08
sp|O93982|HOG1_ZYGRC Mitogen-activated protein kinase HOG1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=HOG1 PE=3 SV=2 6 155 4.0E-08
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 16 257 4.0E-08
sp|P9WI63|PKNL_MYCTU Serine/threonine-protein kinase PknL OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknL PE=1 SV=1 1 256 4.0E-08
sp|P9WI62|PKNL_MYCTO Serine/threonine-protein kinase PknL OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknL PE=3 SV=1 1 256 4.0E-08
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 16 224 4.0E-08
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 8 210 4.0E-08
sp|A2QN07|MPKC_ASPNC Mitogen-activated protein kinase mpkC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mpkC PE=3 SV=1 6 239 4.0E-08
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 8 217 4.0E-08
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 1 212 4.0E-08
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 1 212 4.0E-08
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 1 212 4.0E-08
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 1 212 4.0E-08
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 8 210 4.0E-08
sp|Q6CVA2|STE20_KLULA Serine/threonine-protein kinase STE20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE20 PE=3 SV=1 10 212 4.0E-08
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 8 217 4.0E-08
sp|O14408|KCC1_METAN Calcium/calmodulin-dependent protein kinase OS=Metarhizium anisopliae PE=2 SV=1 7 214 4.0E-08
sp|Q9R011|PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus GN=Plk3 PE=1 SV=2 7 280 4.0E-08
sp|Q9UPZ9|ICK_HUMAN Serine/threonine-protein kinase ICK OS=Homo sapiens GN=ICK PE=1 SV=1 8 155 5.0E-08
sp|P35567|CDK1A_XENLA Cyclin-dependent kinase 1-A OS=Xenopus laevis GN=cdk1-a PE=1 SV=1 15 157 5.0E-08
sp|Q92207|HOG1_CANAL Mitogen-activated protein kinase HOG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HOG1 PE=1 SV=2 6 256 5.0E-08
sp|P11730|KCC2G_RAT Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Rattus norvegicus GN=Camk2g PE=1 SV=1 1 175 5.0E-08
sp|O59854|HOG1_ZYGRO Mitogen-activated protein kinase HOG1 OS=Zygosaccharomyces rouxii GN=HOG1 PE=3 SV=1 6 155 5.0E-08
sp|P00521|ABL_MLVAB Tyrosine-protein kinase transforming protein Abl OS=Abelson murine leukemia virus GN=ABL PE=3 SV=1 12 288 5.0E-08
sp|P33973|PKN1_MYXXA Serine/threonine-protein kinase Pkn1 OS=Myxococcus xanthus GN=pkn1 PE=1 SV=1 8 207 5.0E-08
sp|A7SNN5|PLK4_NEMVE Serine/threonine-protein kinase PLK4 OS=Nematostella vectensis GN=v1g246408 PE=3 SV=1 16 207 6.0E-08
sp|Q923T9|KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus GN=Camk2g PE=1 SV=1 1 175 6.0E-08
sp|Q9XUJ7|DKF1_CAEEL Serine/threonine-protein kinase dkf-1 OS=Caenorhabditis elegans GN=dkf-1 PE=1 SV=1 13 223 6.0E-08
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 5 210 6.0E-08
sp|Q55FJ6|Y8078_DICDI Probable serine/threonine-protein kinase DDB_G0268078 OS=Dictyostelium discoideum GN=DDB_G0268078 PE=3 SV=1 9 155 6.0E-08
sp|Q13555|KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens GN=CAMK2G PE=1 SV=3 1 175 6.0E-08
sp|Q06850|CDPK1_ARATH Calcium-dependent protein kinase 1 OS=Arabidopsis thaliana GN=CPK1 PE=1 SV=1 10 157 6.0E-08
sp|Q01917|CDC2H_CRIFA Cell division control protein 2 homolog OS=Crithidia fasciculata GN=CRK PE=3 SV=1 8 185 6.0E-08
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 8 210 6.0E-08
sp|P53681|CRK_DAUCA CDPK-related protein kinase OS=Daucus carota GN=CRK PE=2 SV=1 8 210 6.0E-08
sp|Q4KTY1|KPSH1_PINFU Serine/threonine-protein kinase H1 homolog OS=Pinctada fucata GN=PSKH1 PE=2 SV=1 3 207 6.0E-08
sp|P24033|CDK1B_XENLA Cyclin-dependent kinase 1-B OS=Xenopus laevis GN=cdk1-b PE=1 SV=2 15 157 6.0E-08
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 4 154 6.0E-08
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 10 212 7.0E-08
sp|Q9JKV2|ICK_MOUSE Serine/threonine-protein kinase ICK OS=Mus musculus GN=Ick PE=1 SV=2 8 155 7.0E-08
sp|Q62726|ICK_RAT Serine/threonine-protein kinase ICK OS=Rattus norvegicus GN=Ick PE=1 SV=1 8 155 7.0E-08
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 8 214 7.0E-08
sp|B4HBU3|PLK4_DROPE Serine/threonine-protein kinase PLK4 OS=Drosophila persimilis GN=SAK PE=3 SV=1 10 208 7.0E-08
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 16 212 7.0E-08
sp|B4J3F1|PLK4_DROGR Serine/threonine-protein kinase PLK4 OS=Drosophila grimshawi GN=SAK PE=3 SV=1 10 207 7.0E-08
sp|O59853|HOG2_ZYGRO Mitogen-activated protein kinase HOG2 OS=Zygosaccharomyces rouxii GN=HOG2 PE=3 SV=1 6 155 7.0E-08
sp|Q2LYK3|PLK4_DROPS Serine/threonine-protein kinase PLK4 OS=Drosophila pseudoobscura pseudoobscura GN=SAK PE=3 SV=1 10 208 7.0E-08
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 15 255 8.0E-08
sp|A8XWC4|DKF1_CAEBR Serine/threonine-protein kinase dkf-1 OS=Caenorhabditis briggsae GN=dkf-1 PE=3 SV=2 13 207 8.0E-08
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 15 255 8.0E-08
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 9 209 8.0E-08
sp|Q55FS2|STK4L_DICDI Serine/threonine-protein kinase 4 homolog B OS=Dictyostelium discoideum GN=krsB PE=3 SV=1 16 158 8.0E-08
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 15 255 8.0E-08
sp|Q21029|NSY1_CAEEL Mitogen-activated protein kinase kinase kinase nsy-1 OS=Caenorhabditis elegans GN=nsy-1 PE=1 SV=4 16 207 9.0E-08
sp|P53684|CDPKB_ORYSJ Calcium-dependent protein kinase isoform 11 OS=Oryza sativa subsp. japonica GN=CPK11 PE=2 SV=2 10 157 9.0E-08
sp|E9PT87|MYLK3_RAT Myosin light chain kinase 3 OS=Rattus norvegicus GN=Mylk3 PE=1 SV=1 1 214 9.0E-08
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 8 207 9.0E-08
sp|P93759|CDPKE_ARATH Calcium-dependent protein kinase 14 OS=Arabidopsis thaliana GN=CPK14 PE=2 SV=1 6 157 9.0E-08
sp|Q54SJ5|MYLKC_DICDI Probable myosin light chain kinase DDB_G0282429 OS=Dictyostelium discoideum GN=DDB_G0282429 PE=3 SV=1 7 213 9.0E-08
sp|Q5ZJK4|STK4_CHICK Serine/threonine-protein kinase 4 OS=Gallus gallus GN=STK4 PE=2 SV=1 15 255 9.0E-08
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 15 255 9.0E-08
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 81 209 9.0E-08
sp|P00520|ABL1_MOUSE Tyrosine-protein kinase ABL1 OS=Mus musculus GN=Abl1 PE=1 SV=3 12 288 9.0E-08
sp|Q2U469|MPKC_ASPOR Mitogen-activated protein kinase mpkC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mpkC PE=3 SV=2 6 155 1.0E-07
sp|O64556|Y2923_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g19230 OS=Arabidopsis thaliana GN=At2g19230 PE=3 SV=3 5 236 1.0E-07
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 16 209 1.0E-07
sp|Q8NJT7|HOG1_HORWE Mitogen-activated protein kinase HOG1 OS=Hortaea werneckii GN=HOG1 PE=3 SV=1 6 155 1.0E-07
sp|P46892|CD11B_RAT Cyclin-dependent kinase 11B OS=Rattus norvegicus GN=Cdk11b PE=1 SV=1 15 281 1.0E-07
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 16 227 1.0E-07
sp|Q07785|CDC2H_PLAFK Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CRK2 PE=1 SV=1 15 157 1.0E-07
sp|P61075|CDC2H_PLAF7 Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate 3D7) GN=CRK2 PE=3 SV=1 15 157 1.0E-07
sp|O08605|MKNK1_MOUSE MAP kinase-interacting serine/threonine-protein kinase 1 OS=Mus musculus GN=Mknk1 PE=1 SV=2 16 214 1.0E-07
sp|Q1ZXH2|FHKB_DICDI Probable serine/threonine-protein kinase fhkB OS=Dictyostelium discoideum GN=fhkB PE=3 SV=1 16 201 1.0E-07
sp|Q0CIC7|MPKC_ASPTN Mitogen-activated protein kinase mpkC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mpkC PE=3 SV=2 9 155 1.0E-07
sp|P29618|CDKA1_ORYSJ Cyclin-dependent kinase A-1 OS=Oryza sativa subsp. japonica GN=CDKA-1 PE=1 SV=1 9 157 1.0E-07
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 1 209 1.0E-07
sp|Q1KTF2|HOG1_ZYMTI Mitogen-activated protein kinase Hog1 OS=Zymoseptoria tritici (strain CBS 115943 / IPO323) GN=Hog1 PE=3 SV=2 6 155 1.0E-07
sp|Q54B33|PAKE_DICDI Serine/threonine-protein kinase pakE OS=Dictyostelium discoideum GN=pakE PE=3 SV=1 6 209 1.0E-07
sp|Q38772|CDC2A_ANTMA Cell division control protein 2 homolog A OS=Antirrhinum majus GN=CDC2A PE=2 SV=2 15 157 1.0E-07
sp|P08092|RAN1_SCHPO Negative regulator of sexual conjugation and meiosis OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ran1 PE=1 SV=2 16 154 1.0E-07
sp|Q5EDC3|CDK20_MACMU Cyclin-dependent kinase 20 OS=Macaca mulatta GN=CDK20 PE=2 SV=1 9 158 1.0E-07
sp|Q8L4H4|NORK_MEDTR Nodulation receptor kinase OS=Medicago truncatula GN=NORK PE=1 SV=2 16 212 1.0E-07
sp|Q9FAB3|SPKA_SYNY3 Serine/threonine-protein kinase A OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=spkA PE=1 SV=1 5 206 1.0E-07
sp|Q1ZXC8|PXI_DICDI Probable serine/threonine-protein kinase pXi OS=Dictyostelium discoideum GN=pXi PE=2 SV=1 10 155 1.0E-07
sp|Q04859|MAK_MOUSE Serine/threonine-protein kinase MAK OS=Mus musculus GN=Mak PE=1 SV=2 8 155 1.0E-07
sp|Q9SIQ7|CDPKO_ARATH Calcium-dependent protein kinase 24 OS=Arabidopsis thaliana GN=CPK24 PE=2 SV=1 6 157 1.0E-07
sp|P32023|KGP25_DROME cGMP-dependent protein kinase, isozyme 2 forms cD5/T2 OS=Drosophila melanogaster GN=for PE=2 SV=3 11 212 1.0E-07
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 16 209 1.0E-07
sp|Q9W739|CDK1_RANDY Cyclin-dependent kinase 1 OS=Rana dybowskii GN=CDK1 PE=2 SV=1 15 157 1.0E-07
sp|A4K2P5|STK4_COLGU Serine/threonine-protein kinase 4 OS=Colobus guereza GN=STK4 PE=3 SV=1 15 255 1.0E-07
sp|Q93VK0|PPCK2_ARATH Phosphoenolpyruvate carboxylase kinase 2 OS=Arabidopsis thaliana GN=PPCK2 PE=1 SV=2 10 251 1.0E-07
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 16 209 1.0E-07
sp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 24 OS=Oryza sativa subsp. japonica GN=CIPK24 PE=1 SV=1 8 208 1.0E-07
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 109 227 1.0E-07
sp|Q54W86|MYLKF_DICDI Probable myosin light chain kinase DDB_G0279831 OS=Dictyostelium discoideum GN=DDB_G0279831 PE=3 SV=1 7 154 1.0E-07
sp|Q00372|SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF1 PE=3 SV=2 8 154 1.0E-07
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=3 SV=1 15 255 1.0E-07
sp|Q4KM34|CDK20_RAT Cyclin-dependent kinase 20 OS=Rattus norvegicus GN=Cdk20 PE=2 SV=2 9 158 1.0E-07
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 8 207 1.0E-07
sp|A8WIP6|CDK20_DANRE Cyclin-dependent kinase 20 OS=Danio rerio GN=cdk20 PE=2 SV=1 9 173 1.0E-07
sp|Q8NEV4|MYO3A_HUMAN Myosin-IIIa OS=Homo sapiens GN=MYO3A PE=2 SV=2 16 160 1.0E-07
sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 8 213 1.0E-07
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 109 227 1.0E-07
sp|Q9JHU3|CDK20_MOUSE Cyclin-dependent kinase 20 OS=Mus musculus GN=Cdk20 PE=1 SV=1 9 158 1.0E-07
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 16 207 1.0E-07
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 109 227 1.0E-07
sp|P00519|ABL1_HUMAN Tyrosine-protein kinase ABL1 OS=Homo sapiens GN=ABL1 PE=1 SV=4 12 288 1.0E-07
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 16 210 1.0E-07
sp|B4KYX8|PLK4_DROMO Serine/threonine-protein kinase PLK4 OS=Drosophila mojavensis GN=SAK PE=3 SV=1 10 207 1.0E-07
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 109 257 2.0E-07
sp|Q55D99|PAKA_DICDI Serine/threonine-protein kinase pakA OS=Dictyostelium discoideum GN=pakA PE=1 SV=1 15 207 2.0E-07
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 15 212 2.0E-07
sp|Q8TGA9|HOG1_BLUGR Mitogen-activated protein kinase HOG1 OS=Blumeria graminis GN=HOG1 PE=3 SV=1 6 155 2.0E-07
sp|P28829|BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr2 PE=1 SV=1 16 169 2.0E-07
sp|Q42479|CDPK3_ARATH Calcium-dependent protein kinase 3 OS=Arabidopsis thaliana GN=CPK3 PE=1 SV=1 6 158 2.0E-07
sp|Q0D0P5|HOG1_ASPTN Mitogen-activated protein kinase hog1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hog1 PE=3 SV=2 6 155 2.0E-07
sp|Q54LR6|Y6481_DICDI Probable serine/threonine-protein kinase DDB_G0286481 OS=Dictyostelium discoideum GN=DDB_G0286481 PE=3 SV=1 9 157 2.0E-07
sp|P20794|MAK_HUMAN Serine/threonine-protein kinase MAK OS=Homo sapiens GN=MAK PE=1 SV=2 8 155 2.0E-07
sp|A1CPG7|HOG1_ASPCL Mitogen-activated protein kinase hog1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hog1 PE=3 SV=1 6 155 2.0E-07
sp|P32485|HOG1_YEAST Mitogen-activated protein kinase HOG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOG1 PE=1 SV=2 6 155 2.0E-07
sp|O96017|CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens GN=CHEK2 PE=1 SV=1 10 207 2.0E-07
sp|Q8SR83|CDC72_ENCCU Probable cell division control protein 7 homolog 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC7-2 PE=3 SV=1 6 155 2.0E-07
sp|O54748|STK3_RAT Serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Stk3 PE=1 SV=1 15 255 2.0E-07
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 8 208 2.0E-07
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 10 212 2.0E-07
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 15 212 2.0E-07
sp|Q6FIU2|HOG1_CANGA Mitogen-activated protein kinase HOG1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HOG1 PE=3 SV=1 6 155 2.0E-07
sp|Q8SR85|CDC71_ENCCU Probable cell division control protein 7 homolog 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC7-1 PE=3 SV=1 6 155 2.0E-07
sp|Q9LMT0|CDKD3_ARATH Cyclin-dependent kinase D-3 OS=Arabidopsis thaliana GN=CDKD-3 PE=1 SV=1 6 161 2.0E-07
sp|Q5JLD8|CIPK8_ORYSJ CBL-interacting protein kinase 8 OS=Oryza sativa subsp. japonica GN=CIPK8 PE=2 SV=1 8 207 2.0E-07
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 15 212 2.0E-07
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 8 210 2.0E-07
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 5 207 2.0E-07
sp|P51567|AFC2_ARATH Serine/threonine-protein kinase AFC2 OS=Arabidopsis thaliana GN=AFC2 PE=1 SV=1 6 137 2.0E-07
sp|D0N4E2|PKZ1_PHYIT Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans (strain T30-4) GN=PKZ1 PE=3 SV=1 15 235 2.0E-07
sp|Q8SSV3|MKCD_DICDI Probable serine/threonine-protein kinase mkcD OS=Dictyostelium discoideum GN=mkcD PE=3 SV=1 17 211 2.0E-07
sp|A1D2C9|HOG1_NEOFI Mitogen-activated protein kinase hog1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hog1 PE=3 SV=1 6 155 2.0E-07
sp|Q8GVC7|PKZ1_PHYIN Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans GN=PKZ1 PE=1 SV=1 15 235 2.0E-07
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 10 154 2.0E-07
sp|A2QRF6|HOG1_ASPNC Mitogen-activated protein kinase hog1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=hog1 PE=3 SV=2 6 155 2.0E-07
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 9 238 2.0E-07
sp|Q4WSF6|HOG1_ASPFU Mitogen-activated protein kinase hog1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hog1 PE=1 SV=1 6 155 2.0E-07
sp|P20793|MAK_RAT Serine/threonine-protein kinase MAK OS=Rattus norvegicus GN=Mak PE=1 SV=2 8 155 2.0E-07
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 1 209 2.0E-07
sp|P45894|AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans GN=aak-1 PE=2 SV=2 8 207 2.0E-07
sp|Q8LKZ1|NORK_PEA Nodulation receptor kinase OS=Pisum sativum GN=NORK PE=1 SV=1 16 212 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0044238 primary metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4978
MKDIIVNGRYRVDYRIGEGGFGLVYAGTDIMSGQEVAMKLMPVKDNSEIIEGEVEAYKALAGGIGIPQVLWFGPD
SDYYVLVHELLGPSLEDLFNYCGRRFSLKTVLLIADQALSRIEYIHDRGFLHHDIKPENFLMGTGRQGNILYTID
FGLAQGFSGVNSEGWAFGGTSRYASLNNHNGHEQSWSDDLESLGYVLLYFARGSLPWQGRKPADGKEENELIKEM
KMKSSTMLCDGLPREFATYLDHVWSLGFSDRPNYSHLRRLFGRLFLSRGFKHDNVFDWTEKRFRELQSLTVEPKT
GDRLDPRTGEEKIRGE*
Coding >Hirsu2|4978
ATGAAGGACATCATAGTCAATGGCAGGTACCGTGTCGACTACAGGATTGGCGAAGGCGGGTTTGGTCTCGTCTAT
GCCGGGACTGATATCATGTCCGGTCAAGAGGTCGCAATGAAGCTCATGCCTGTAAAAGACAACTCGGAAATCATT
GAAGGCGAAGTGGAAGCCTATAAGGCACTTGCTGGAGGCATTGGCATACCGCAAGTCCTCTGGTTCGGCCCGGAT
TCTGACTACTACGTATTGGTCCATGAGCTCCTCGGCCCTTCGCTTGAAGACCTTTTCAACTACTGTGGAAGACGA
TTTTCATTGAAGACCGTCCTCCTCATCGCCGACCAGGCCCTGTCGCGGATTGAATACATTCACGACAGGGGCTTT
CTACATCACGACATCAAGCCGGAAAACTTCCTTATGGGGACCGGCCGGCAAGGCAACATTCTGTACACGATTGAC
TTTGGTTTGGCTCAGGGGTTCTCCGGCGTCAACTCGGAAGGATGGGCGTTCGGCGGCACAAGTCGATACGCCAGC
CTCAACAACCACAACGGCCACGAGCAGTCTTGGAGCGATGATCTGGAATCCCTCGGATACGTGCTGCTGTATTTC
GCTCGCGGGTCGTTGCCATGGCAAGGCCGGAAACCCGCGGATGGCAAGGAGGAGAATGAATTGATCAAAGAGATG
AAGATGAAGTCGTCGACGATGCTCTGTGACGGACTGCCTCGGGAGTTCGCCACATACCTCGACCATGTCTGGTCG
CTCGGATTCAGTGATCGGCCCAACTATTCACATCTTCGTCGGCTCTTTGGTCGCCTGTTTTTGAGTCGCGGCTTC
AAGCACGACAATGTCTTCGACTGGACTGAGAAGCGTTTCCGGGAGCTGCAGAGTCTTACGGTCGAGCCGAAAACA
GGCGACCGACTAGACCCCCGGACCGGCGAGGAGAAAATACGTGGAGAGTGA
Transcript >Hirsu2|4978
ATGAAGGACATCATAGTCAATGGCAGGTACCGTGTCGACTACAGGATTGGCGAAGGCGGGTTTGGTCTCGTCTAT
GCCGGGACTGATATCATGTCCGGTCAAGAGGTCGCAATGAAGCTCATGCCTGTAAAAGACAACTCGGAAATCATT
GAAGGCGAAGTGGAAGCCTATAAGGCACTTGCTGGAGGCATTGGCATACCGCAAGTCCTCTGGTTCGGCCCGGAT
TCTGACTACTACGTATTGGTCCATGAGCTCCTCGGCCCTTCGCTTGAAGACCTTTTCAACTACTGTGGAAGACGA
TTTTCATTGAAGACCGTCCTCCTCATCGCCGACCAGGCCCTGTCGCGGATTGAATACATTCACGACAGGGGCTTT
CTACATCACGACATCAAGCCGGAAAACTTCCTTATGGGGACCGGCCGGCAAGGCAACATTCTGTACACGATTGAC
TTTGGTTTGGCTCAGGGGTTCTCCGGCGTCAACTCGGAAGGATGGGCGTTCGGCGGCACAAGTCGATACGCCAGC
CTCAACAACCACAACGGCCACGAGCAGTCTTGGAGCGATGATCTGGAATCCCTCGGATACGTGCTGCTGTATTTC
GCTCGCGGGTCGTTGCCATGGCAAGGCCGGAAACCCGCGGATGGCAAGGAGGAGAATGAATTGATCAAAGAGATG
AAGATGAAGTCGTCGACGATGCTCTGTGACGGACTGCCTCGGGAGTTCGCCACATACCTCGACCATGTCTGGTCG
CTCGGATTCAGTGATCGGCCCAACTATTCACATCTTCGTCGGCTCTTTGGTCGCCTGTTTTTGAGTCGCGGCTTC
AAGCACGACAATGTCTTCGACTGGACTGAGAAGCGTTTCCGGGAGCTGCAGAGTCTTACGGTCGAGCCGAAAACA
GGCGACCGACTAGACCCCCGGACCGGCGAGGAGAAAATACGTGGAGAGTGA
Gene >Hirsu2|4978
ATGAAGGTATAAAGCAGCTCATCACAATTGACATGCTCTCATTACTTATTTCCTAGTAGGACATCATAGTCAATG
GCAGGTACCGTGTCGACTACAGGATTGGCGAAGGCGGGTTTGGTCTCGTCTATGCCGGTGCGCTATCACGTCGTG
TTTGCTTCGCTGTGCTTTATGTTGGCTAACCCTTCAATGCCAGGGACTGATATCATGTCCGGTCAAGAGGTCGCA
ATGAAGCTCATGCCTGTAAAAGACAACTCGGAAATCATTGAAGGCGAAGTGGAAGCCTATAAGGCACTTGCTGGA
GGCATTGGCATACCGCAAGTCCTCTGGTTCGGCCCGGATTCTGACTACTACGTATTGGTCCATGAGCTCCTCGGC
CCTTCGCTTGAAGACCTTTTCAACTACTGTGGAAGACGATTTTCATTGAAGACCGTCCTCCTCATCGCCGACCAG
GCCCTGTCGCGGATTGAATACATTCACGACAGGGGCTTTCTACATCACGACATCAAGCCGGAAAACTTCCTTATG
GGGACCGGCCGGCAAGGCAACATTCTGTACACGATTGACTTTGGTTTGGCTCAGGGGTTCTCCGGCGTCAACTCG
GAAGGATGGGCGTTCGGCGGCACAAGTCGATACGCCAGCCTCAACAACCACAACGGCCACGGTAAGTGCGATCGA
TCTCCGTAGGTGCTATCGATTCTGACTACTTCGACAGAGCAGTCTTGGAGCGATGATCTGGAATCCCTCGGATAC
GTGCTGCTGTATTTCGCTCGCGGGTCGTTGCCATGGCAAGGCCGGAAACCCGCGGATGGCAAGGAGGAGAATGAA
TTGATCAAAGAGATGAAGATGAAGTCGTCGACGATGCTCTGTGACGGACTGCCTCGGGAGTTCGCCACATACCTC
GACCATGTCTGGTCGCTCGGATTCAGTGATCGGCCCAACTATTCACATCTTCGTCGGCTCTTTGGTCGCCTGTTT
TTGAGTCGCGGCTTCAAGCACGACAATGTCTTCGACTGGACTGAGAAGCGTTTCCGGGAGCTGCAGAGTCTTACG
GTCGAGCCGAAAACAGGCGACCGACTAGACCCCCGGACCGGCGAGGAGAAAATACGTGGAGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail