Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4975
Gene name
LocationContig_25:23519..24432
Strand+
Gene length (bp)913
Transcript length (bp)786
Coding sequence length (bp)786
Protein length (aa) 262

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01328 Peroxidase_2 Peroxidase, family 2 3.4E-22 1 170

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q00668|STCC_EMENI Putative sterigmatocystin biosynthesis peroxidase stcC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcC PE=3 SV=2 1 198 2.0E-07

GO

GO Term Description Terminal node
GO:0004601 peroxidase activity Yes
GO:0016491 oxidoreductase activity No
GO:0016209 antioxidant activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4975
LANHGFLPKNGKKITIVDIIIACFVGFGVSPVTSALLTADGLEESGRDLDAVFDLVDVQKRNFGIEHDASFSRRD
ASTGDITRLDPQAWAETLAALQRCGAVSPQCFGVAKLARIDGERRRNPRSDYNRDAAGYGAAEVGMLLGVYNPLE
RGDAMAFCIRALFQAEQIPPPCRPTSVTARFHTVLDIAEASVKTDRRLQVTSNGTVKDQNDILEVTGGNEVPVLA
LKQALRVAGFANDKEVRSVLTWLGRRPQNRHNKKAS*
Coding >Hirsu2|4975
CTGGCGAACCACGGGTTCCTGCCGAAGAACGGCAAGAAGATCACCATCGTGGACATCATCATCGCCTGCTTCGTC
GGCTTCGGCGTCTCGCCCGTGACGAGCGCGCTGCTGACGGCGGACGGGCTGGAGGAGTCCGGGCGCGACCTCGAC
GCCGTCTTCGACCTGGTCGACGTGCAGAAGCGCAACTTCGGCATCGAGCACGACGCCAGCTTCTCGCGCCGCGAC
GCCTCCACCGGCGACATCACCCGCCTCGACCCGCAGGCCTGGGCCGAGACGCTGGCGGCGCTGCAGCGCTGCGGC
GCCGTCAGCCCGCAGTGCTTCGGCGTCGCCAAGCTGGCCCGTATCGACGGCGAGCGCCGCCGCAACCCGCGCTCC
GACTACAACCGCGACGCCGCCGGCTACGGCGCCGCCGAGGTCGGCATGCTGCTCGGCGTCTACAACCCGCTCGAG
CGCGGCGATGCTATGGCCTTCTGCATCCGCGCCCTCTTCCAGGCCGAGCAGATCCCGCCGCCGTGCCGGCCGACC
AGCGTCACCGCCAGGTTCCACACCGTCCTCGACATCGCCGAGGCCTCCGTCAAGACCGACAGGCGCCTGCAGGTG
ACGAGCAACGGGACCGTCAAGGATCAGAATGACATACTCGAAGTCACCGGCGGAAATGAGGTGCCGGTTCTGGCG
CTGAAGCAGGCTCTACGAGTCGCCGGCTTCGCCAACGACAAAGAGGTCCGCAGCGTCTTGACCTGGCTTGGCCGC
AGGCCGCAGAACCGCCACAACAAGAAGGCCAGCTGA
Transcript >Hirsu2|4975
CTGGCGAACCACGGGTTCCTGCCGAAGAACGGCAAGAAGATCACCATCGTGGACATCATCATCGCCTGCTTCGTC
GGCTTCGGCGTCTCGCCCGTGACGAGCGCGCTGCTGACGGCGGACGGGCTGGAGGAGTCCGGGCGCGACCTCGAC
GCCGTCTTCGACCTGGTCGACGTGCAGAAGCGCAACTTCGGCATCGAGCACGACGCCAGCTTCTCGCGCCGCGAC
GCCTCCACCGGCGACATCACCCGCCTCGACCCGCAGGCCTGGGCCGAGACGCTGGCGGCGCTGCAGCGCTGCGGC
GCCGTCAGCCCGCAGTGCTTCGGCGTCGCCAAGCTGGCCCGTATCGACGGCGAGCGCCGCCGCAACCCGCGCTCC
GACTACAACCGCGACGCCGCCGGCTACGGCGCCGCCGAGGTCGGCATGCTGCTCGGCGTCTACAACCCGCTCGAG
CGCGGCGATGCTATGGCCTTCTGCATCCGCGCCCTCTTCCAGGCCGAGCAGATCCCGCCGCCGTGCCGGCCGACC
AGCGTCACCGCCAGGTTCCACACCGTCCTCGACATCGCCGAGGCCTCCGTCAAGACCGACAGGCGCCTGCAGGTG
ACGAGCAACGGGACCGTCAAGGATCAGAATGACATACTCGAAGTCACCGGCGGAAATGAGGTGCCGGTTCTGGCG
CTGAAGCAGGCTCTACGAGTCGCCGGCTTCGCCAACGACAAAGAGGTCCGCAGCGTCTTGACCTGGCTTGGCCGC
AGGCCGCAGAACCGCCACAACAAGAAGGCCAGCTGA
Gene >Hirsu2|4975
CTGGCGAACCACGGGTTCCTGCCGAAGAACGGCAAGAAGATCACCATCGTGGACATCATCATCGCCTGCTTCGTC
GGCTTCGGCGTCTCGCCCGTGACGAGCGCGCTGCTGACGGCGGACGGGCTGGAGGAGTCCGGGCGCGACCTCGAC
GCCGTCTTCGACCTGGTCGACGTGCAGAAGCGCAACTTCGGCATCGAGCACGACGCCAGCTTCTCGCGCCGCGAC
GCCTCCACCGGCGACATCACCCGCCTCGACCCGCAGGCCTGGGCCGAGACGCTGGCGGCGCTGCAGCGCTGCGGC
GCCGTCAGCCCGCAGTGCTTCGGCGTCGCCAAGCTGGCCCGTATCGACGGCGAGCGCCGCCGCAACCCGCGCTCC
GACTACAACCGCGACGCCGCCGGCTACGGCGCCGCCGAGGTCGGCATGCTGCTCGGCGTCTACAACCCGCTCGAG
CGCGGCGATGCTATGGCCTTCTGCATCCGCGCCCTCTTCCAGGCCGAGCAGATCCCGCCGCCGTGCCGGCCGACC
AGCGTCACCGCCAGGTTCCACACCGTCCTCGACATCGCCGAGGCCTCCGTCAAGACCGACAGGCGCCTGCAGGTG
ACGAGCAACGGGACCGTCAAGGATCAGAATGTACGTTGCTTGTCCTCTTCCCCCCGTTCTTCCTCCCTCCTTTCT
GCCACCCCCTTGGGAGGACTGGCCCGTCGTGTGTGGCCAACGCGGTGACGATGGCTCTGTCTCACCCGCCTTTGA
AACCCAGGACATACTCGAAGTCACCGGCGGAAATGAGGTGCCGGTTCTGGCGCTGAAGCAGGCTCTACGAGTCGC
CGGCTTCGCCAACGACAAAGAGGTCCGCAGCGTCTTGACCTGGCTTGGCCGCAGGCCGCAGAACCGCCACAACAA
GAAGGCCAGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail