Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4974
Gene name
LocationContig_25:22991..23290
Strand+
Gene length (bp)299
Transcript length (bp)222
Coding sequence length (bp)222
Protein length (aa) 74

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.2257 0.1476 0.8392 0.1642 0.3066 0.3463 0.0883 0.1073 0.0974 0.0408

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.999548

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup9760
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|4974 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4974
MKLRLLSALLAVGAAADSADAGSEHKPRGKIFGVLRDQAYCVAHQIPFFGTFVSQRLTHPEDPDAWMKKSGRL*
Coding >Hirsu2|4974
ATGAAGTTGAGGCTCTTGTCCGCCCTCTTGGCCGTCGGGGCCGCGGCAGACTCGGCGGACGCCGGCTCCGAGCAC
AAGCCGCGGGGCAAGATCTTTGGCGTGCTCCGAGACCAGGCGTACTGCGTGGCCCATCAGATCCCCTTCTTCGGC
ACCTTCGTCAGCCAGCGGCTCACGCACCCGGAAGATCCGGATGCGTGGATGAAGAAGTCCGGGAGATTGTAA
Transcript >Hirsu2|4974
ATGAAGTTGAGGCTCTTGTCCGCCCTCTTGGCCGTCGGGGCCGCGGCAGACTCGGCGGACGCCGGCTCCGAGCAC
AAGCCGCGGGGCAAGATCTTTGGCGTGCTCCGAGACCAGGCGTACTGCGTGGCCCATCAGATCCCCTTCTTCGGC
ACCTTCGTCAGCCAGCGGCTCACGCACCCGGAAGATCCGGATGCGTGGATGAAGAAGTCCGGGAGATTGTAA
Gene >Hirsu2|4974
ATGAAGTTGAGGCTCTTGTCCGCCCTCTTGGCCGTCGGGGCCGCGGCAGACTCGGCGGACGCCGGCTCCGAGCAC
AAGCCGCGGGGCAAGATCTTTGGCGTGCTCCGAGACCAGGCGTACTGCGTGGCCCATCAGATCCCCTTCTTCGGC
ACCTTCGTCAGCCAGCGGCTCACGCACCCGGAAGATCCGGATGCGTGGATGAAGAAGTGTTGGTGGTTTGTGCCC
AAGGTCATACCGAAAATCAACCCGGCCGACAAGCGGTTCGACACCTTCCACCAACGTCAGCCGGGAGATTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail