Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4970
Gene name
LocationContig_25:16475..17468
Strand-
Gene length (bp)993
Transcript length (bp)909
Coding sequence length (bp)909
Protein length (aa) 303

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08241 Methyltransf_11 Methyltransferase domain 2.9E-20 41 135
PF13649 Methyltransf_25 Methyltransferase domain 2.0E-17 41 131
PF13847 Methyltransf_31 Methyltransferase domain 3.0E-10 40 135
PF08242 Methyltransf_12 Methyltransferase domain 4.0E-08 41 133
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 5.3E-06 39 134

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32643|TMT1_YEAST Trans-aconitate 3-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMT1 PE=1 SV=1 1 301 2.0E-35
sp|A6ZRD1|TMT1_YEAS7 Trans-aconitate 3-methyltransferase OS=Saccharomyces cerevisiae (strain YJM789) GN=TMT1 PE=3 SV=1 1 301 2.0E-35
sp|P38892|CRG1_YEAST Probable S-adenosylmethionine-dependent methyltransferase CRG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRG1 PE=1 SV=1 4 269 9.0E-30
sp|Q55EX9|Y8948_DICDI Putative methyltransferase DDB_G0268948 OS=Dictyostelium discoideum GN=DDB_G0268948 PE=1 SV=2 4 138 1.0E-17
sp|O31474|YCGJ_BACSU Uncharacterized methyltransferase YcgJ OS=Bacillus subtilis (strain 168) GN=ycgJ PE=1 SV=2 40 156 3.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32643|TMT1_YEAST Trans-aconitate 3-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMT1 PE=1 SV=1 1 301 2.0E-35
sp|A6ZRD1|TMT1_YEAS7 Trans-aconitate 3-methyltransferase OS=Saccharomyces cerevisiae (strain YJM789) GN=TMT1 PE=3 SV=1 1 301 2.0E-35
sp|P38892|CRG1_YEAST Probable S-adenosylmethionine-dependent methyltransferase CRG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRG1 PE=1 SV=1 4 269 9.0E-30
sp|Q55EX9|Y8948_DICDI Putative methyltransferase DDB_G0268948 OS=Dictyostelium discoideum GN=DDB_G0268948 PE=1 SV=2 4 138 1.0E-17
sp|O31474|YCGJ_BACSU Uncharacterized methyltransferase YcgJ OS=Bacillus subtilis (strain 168) GN=ycgJ PE=1 SV=2 40 156 3.0E-11
sp|Q9UTA8|YL8A_SCHPO Uncharacterized methyltransferase-like C25B8.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.10 PE=3 SV=1 11 156 7.0E-10
sp|Q9UTA9|YL89_SCHPO Uncharacterized methyltransferase C25B8.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.09 PE=3 SV=1 12 155 7.0E-10
sp|P65349|Y3374_MYCBO Uncharacterized methyltransferase Mb3374 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb3374 PE=3 SV=1 8 143 4.0E-08
sp|P9WK01|Y3342_MYCTU Uncharacterized methyltransferase Rv3342 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3342 PE=1 SV=1 8 143 4.0E-08
sp|P9WK00|Y3342_MYCTO Uncharacterized methyltransferase MT3445 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT3445 PE=3 SV=1 8 143 4.0E-08
sp|P74388|BQMT_SYNY3 2-methyl-6-phytyl-1,4-hydroquinone methyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0418 PE=1 SV=1 36 141 7.0E-06
sp|Q8EDK8|BIOC_SHEON Malonyl-[acyl-carrier protein] O-methyltransferase OS=Shewanella oneidensis (strain MR-1) GN=bioC PE=3 SV=1 37 131 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4970
MSVFGRASFSAAGYAAARPSYPASLFRTVLGHHRGPKGFLLDLGCGHGIAAREMSPHFGRVMGIDRSAGMIQQAS
SMTAGEANISFRQGGAEDLSFLADGSVDMVVAGQAAHWFDYSKAWPELARVVRRGGSLAFWGYKDNVLVGHARAN
EVLDRFCYAEGEVAPGVEGMQRYWEQPGRERVRQLLRAVEPPAAAWKDVERIEYDVQMDAASAPDAERAWMRKRI
NLGGLEAYLRTFSAFQGWRDAHPQARSRAEEGEGDLADMMMEAIVASEPQWQAMGDRWREAEVETVWGTYILLAR
RS*
Coding >Hirsu2|4970
ATGTCCGTCTTTGGGAGAGCAAGCTTCTCGGCTGCGGGCTACGCGGCTGCGCGGCCATCCTATCCAGCCAGCCTG
TTCAGGACGGTGCTCGGCCATCACCGCGGGCCCAAAGGCTTCCTGCTCGACCTGGGCTGCGGCCACGGCATAGCG
GCGCGAGAGATGAGCCCCCACTTCGGCAGGGTCATGGGCATCGACAGGAGCGCGGGCATGATCCAGCAAGCCTCG
TCGATGACGGCGGGCGAGGCCAACATCAGCTTCCGGCAGGGAGGCGCCGAGGACCTCTCCTTTCTGGCCGACGGC
TCGGTCGACATGGTGGTGGCGGGCCAGGCGGCGCACTGGTTCGACTATTCCAAGGCCTGGCCCGAGCTGGCGCGC
GTCGTCCGGCGCGGAGGCTCGCTCGCCTTCTGGGGATACAAGGACAACGTGCTGGTGGGGCACGCGCGGGCCAAC
GAGGTGCTGGACCGATTCTGCTACGCCGAGGGCGAGGTCGCGCCGGGCGTCGAGGGCATGCAGCGGTACTGGGAG
CAGCCGGGGCGCGAGCGGGTGCGCCAGCTGCTGCGGGCCGTCGAGCCGCCGGCGGCGGCGTGGAAGGACGTCGAG
CGGATCGAGTATGACGTGCAGATGGACGCCGCGAGCGCGCCGGACGCGGAAAGGGCCTGGATGAGGAAGCGCATC
AACCTGGGCGGGCTCGAGGCCTACCTGCGGACCTTCAGCGCCTTCCAGGGCTGGCGAGACGCGCACCCGCAGGCG
AGGAGCCGGGCGGAAGAGGGCGAGGGCGACCTGGCAGACATGATGATGGAGGCCATCGTCGCGTCGGAGCCGCAG
TGGCAGGCCATGGGGGATCGCTGGAGGGAGGCCGAGGTCGAGACGGTCTGGGGCACGTACATTTTGCTGGCGAGG
AGGAGTTGA
Transcript >Hirsu2|4970
ATGTCCGTCTTTGGGAGAGCAAGCTTCTCGGCTGCGGGCTACGCGGCTGCGCGGCCATCCTATCCAGCCAGCCTG
TTCAGGACGGTGCTCGGCCATCACCGCGGGCCCAAAGGCTTCCTGCTCGACCTGGGCTGCGGCCACGGCATAGCG
GCGCGAGAGATGAGCCCCCACTTCGGCAGGGTCATGGGCATCGACAGGAGCGCGGGCATGATCCAGCAAGCCTCG
TCGATGACGGCGGGCGAGGCCAACATCAGCTTCCGGCAGGGAGGCGCCGAGGACCTCTCCTTTCTGGCCGACGGC
TCGGTCGACATGGTGGTGGCGGGCCAGGCGGCGCACTGGTTCGACTATTCCAAGGCCTGGCCCGAGCTGGCGCGC
GTCGTCCGGCGCGGAGGCTCGCTCGCCTTCTGGGGATACAAGGACAACGTGCTGGTGGGGCACGCGCGGGCCAAC
GAGGTGCTGGACCGATTCTGCTACGCCGAGGGCGAGGTCGCGCCGGGCGTCGAGGGCATGCAGCGGTACTGGGAG
CAGCCGGGGCGCGAGCGGGTGCGCCAGCTGCTGCGGGCCGTCGAGCCGCCGGCGGCGGCGTGGAAGGACGTCGAG
CGGATCGAGTATGACGTGCAGATGGACGCCGCGAGCGCGCCGGACGCGGAAAGGGCCTGGATGAGGAAGCGCATC
AACCTGGGCGGGCTCGAGGCCTACCTGCGGACCTTCAGCGCCTTCCAGGGCTGGCGAGACGCGCACCCGCAGGCG
AGGAGCCGGGCGGAAGAGGGCGAGGGCGACCTGGCAGACATGATGATGGAGGCCATCGTCGCGTCGGAGCCGCAG
TGGCAGGCCATGGGGGATCGCTGGAGGGAGGCCGAGGTCGAGACGGTCTGGGGCACGTACATTTTGCTGGCGAGG
AGGAGTTGA
Gene >Hirsu2|4970
ATGTCCGTCTTTGGGTGCGTCATGGGCCGGTCGGGCTTGTCACAACGACGAAATGCACGAATCCACACGAGACGA
GGGCGCTGACTTGTGAGGTGCAGGAGAGCAAGCTTCTCGGCTGCGGGCTACGCGGCTGCGCGGCCATCCTATCCA
GCCAGCCTGTTCAGGACGGTGCTCGGCCATCACCGCGGGCCCAAAGGCTTCCTGCTCGACCTGGGCTGCGGCCAC
GGCATAGCGGCGCGAGAGATGAGCCCCCACTTCGGCAGGGTCATGGGCATCGACAGGAGCGCGGGCATGATCCAG
CAAGCCTCGTCGATGACGGCGGGCGAGGCCAACATCAGCTTCCGGCAGGGAGGCGCCGAGGACCTCTCCTTTCTG
GCCGACGGCTCGGTCGACATGGTGGTGGCGGGCCAGGCGGCGCACTGGTTCGACTATTCCAAGGCCTGGCCCGAG
CTGGCGCGCGTCGTCCGGCGCGGAGGCTCGCTCGCCTTCTGGGGATACAAGGACAACGTGCTGGTGGGGCACGCG
CGGGCCAACGAGGTGCTGGACCGATTCTGCTACGCCGAGGGCGAGGTCGCGCCGGGCGTCGAGGGCATGCAGCGG
TACTGGGAGCAGCCGGGGCGCGAGCGGGTGCGCCAGCTGCTGCGGGCCGTCGAGCCGCCGGCGGCGGCGTGGAAG
GACGTCGAGCGGATCGAGTATGACGTGCAGATGGACGCCGCGAGCGCGCCGGACGCGGAAAGGGCCTGGATGAGG
AAGCGCATCAACCTGGGCGGGCTCGAGGCCTACCTGCGGACCTTCAGCGCCTTCCAGGGCTGGCGAGACGCGCAC
CCGCAGGCGAGGAGCCGGGCGGAAGAGGGCGAGGGCGACCTGGCAGACATGATGATGGAGGCCATCGTCGCGTCG
GAGCCGCAGTGGCAGGCCATGGGGGATCGCTGGAGGGAGGCCGAGGTCGAGACGGTCTGGGGCACGTACATTTTG
CTGGCGAGGAGGAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail