Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4969
Gene name
LocationContig_25:15000..15840
Strand-
Gene length (bp)840
Transcript length (bp)420
Coding sequence length (bp)420
Protein length (aa) 140

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13499 EF-hand_7 EF-hand domain pair 2.8E-08 77 133
PF13833 EF-hand_8 EF-hand domain pair 2.9E-05 89 132

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09196|MLR4_SCHPO Myosin regulatory light chain cdc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc4 PE=1 SV=1 4 139 1.0E-57
sp|P13868|CALM1_SOLTU Calmodulin-1 OS=Solanum tuberosum GN=PCM1 PE=1 SV=2 6 138 1.0E-33
sp|Q9D6P8|CALL3_MOUSE Calmodulin-like protein 3 OS=Mus musculus GN=Calml3 PE=2 SV=1 6 138 2.0E-33
sp|P27161|CALM_SOLLC Calmodulin OS=Solanum lycopersicum GN=CALM1 PE=2 SV=2 6 138 3.0E-33
sp|Q03509|CALM6_ARATH Calmodulin-6 OS=Arabidopsis thaliana GN=CAM6 PE=1 SV=2 4 138 5.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09196|MLR4_SCHPO Myosin regulatory light chain cdc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc4 PE=1 SV=1 4 139 1.0E-57
sp|P13868|CALM1_SOLTU Calmodulin-1 OS=Solanum tuberosum GN=PCM1 PE=1 SV=2 6 138 1.0E-33
sp|Q9D6P8|CALL3_MOUSE Calmodulin-like protein 3 OS=Mus musculus GN=Calml3 PE=2 SV=1 6 138 2.0E-33
sp|P27161|CALM_SOLLC Calmodulin OS=Solanum lycopersicum GN=CALM1 PE=2 SV=2 6 138 3.0E-33
sp|Q03509|CALM6_ARATH Calmodulin-6 OS=Arabidopsis thaliana GN=CAM6 PE=1 SV=2 4 138 5.0E-33
sp|Q682T9|CALM5_ARATH Calmodulin-5 OS=Arabidopsis thaliana GN=CAM5 PE=1 SV=1 4 138 5.0E-33
sp|P0DH98|CALM3_ARATH Calmodulin-3 OS=Arabidopsis thaliana GN=CAM3 PE=1 SV=1 4 138 5.0E-33
sp|P0DH97|CALM2_ARATH Calmodulin-2 OS=Arabidopsis thaliana GN=CAM2 PE=1 SV=1 4 138 5.0E-33
sp|P27164|CALM3_PETHY Calmodulin-related protein OS=Petunia hybrida GN=CAM53 PE=2 SV=2 4 139 7.0E-33
sp|Q40302|CALM_MACPY Calmodulin OS=Macrocystis pyrifera PE=2 SV=3 6 138 8.0E-33
sp|Q5U206|CALL3_RAT Calmodulin-like protein 3 OS=Rattus norvegicus GN=Calml3 PE=2 SV=1 6 138 9.0E-33
sp|P17928|CALM_MEDSA Calmodulin OS=Medicago sativa GN=CAL1 PE=2 SV=2 4 138 1.0E-32
sp|P93171|CALM_HELAN Calmodulin OS=Helianthus annuus GN=CAM PE=2 SV=3 4 138 1.0E-32
sp|P62201|CALM_LILLO Calmodulin OS=Lilium longiflorum PE=2 SV=2 4 138 2.0E-32
sp|Q7Y052|CALM_EUPCH Calmodulin OS=Euphorbia characias PE=2 SV=4 4 138 2.0E-32
sp|P62202|CALM_BRYDI Calmodulin OS=Bryonia dioica PE=2 SV=2 4 138 2.0E-32
sp|P59220|CALM7_ARATH Calmodulin-7 OS=Arabidopsis thaliana GN=CAM7 PE=1 SV=2 4 138 2.0E-32
sp|P62199|CALM1_PETHY Calmodulin-1 OS=Petunia hybrida GN=CAM81 PE=1 SV=2 4 138 2.0E-32
sp|P62200|CALM1_DAUCA Calmodulin-1/11/16 OS=Daucus carota GN=CAM-1 PE=2 SV=2 4 138 2.0E-32
sp|Q7DMN9|CALM5_SOLTU Calmodulin-5/6/7/8 OS=Solanum tuberosum GN=PCM5 PE=1 SV=3 4 138 2.0E-32
sp|P93087|CALM_CAPAN Calmodulin OS=Capsicum annuum GN=CCM1 PE=2 SV=3 4 138 2.0E-32
sp|P04353|CALM_SPIOL Calmodulin OS=Spinacia oleracea PE=1 SV=2 6 138 2.0E-32
sp|P62162|CALM_HORVU Calmodulin OS=Hordeum vulgare GN=CAM PE=2 SV=2 6 138 2.0E-32
sp|P62163|CALM2_SOYBN Calmodulin-2 OS=Glycine max GN=CAM-2 PE=1 SV=2 6 138 2.0E-32
sp|Q0JNS6|CALM1_ORYSJ Calmodulin-1 OS=Oryza sativa subsp. japonica GN=CAM1-1 PE=1 SV=2 6 138 2.0E-32
sp|A2WN93|CALM1_ORYSI Calmodulin-1 OS=Oryza sativa subsp. indica GN=CAM1-1 PE=1 SV=2 6 138 2.0E-32
sp|P69098|CALM_TRYBG Calmodulin OS=Trypanosoma brucei gambiense PE=3 SV=2 4 138 2.0E-32
sp|P69097|CALM_TRYBB Calmodulin OS=Trypanosoma brucei brucei PE=3 SV=2 4 138 2.0E-32
sp|A2WNH1|CALM3_ORYSI Calmodulin-3 OS=Oryza sativa subsp. indica GN=CAM3 PE=3 SV=2 6 138 2.0E-32
sp|O94739|CALM_PLEOS Calmodulin OS=Pleurotus ostreatus GN=CMD1 PE=2 SV=3 4 138 3.0E-32
sp|P27482|CALL3_HUMAN Calmodulin-like protein 3 OS=Homo sapiens GN=CALML3 PE=1 SV=2 4 138 3.0E-32
sp|Q71UH5|CALM_PYTSP Calmodulin OS=Pythium splendens PE=2 SV=1 6 138 3.0E-32
sp|P27165|CALM_PHYIN Calmodulin OS=Phytophthora infestans GN=CMD1 PE=3 SV=2 6 138 3.0E-32
sp|A8I1Q0|CALM_HETTR Calmodulin OS=Heterocapsa triquetra PE=2 SV=1 6 138 3.0E-32
sp|P04464|CALM_WHEAT Calmodulin OS=Triticum aestivum PE=1 SV=3 6 138 3.0E-32
sp|P11120|CALM_PLECO Calmodulin OS=Pleurotus cornucopiae GN=CMD1 PE=1 SV=2 4 138 4.0E-32
sp|P18061|CALM_TRYCR Calmodulin OS=Trypanosoma cruzi GN=CALA2 PE=3 SV=2 4 138 4.0E-32
sp|A3E4D8|CALM_PROMN Calmodulin OS=Prorocentrum minimum PE=2 SV=1 6 138 4.0E-32
sp|A3E3H0|CALM_PFIPI Calmodulin OS=Pfiesteria piscicida PE=2 SV=1 6 138 4.0E-32
sp|A3E4F9|CALM_KARVE Calmodulin OS=Karlodinium veneficum PE=2 SV=1 6 138 4.0E-32
sp|A4UHC0|CALM_ALEFU Calmodulin OS=Alexandrium fundyense PE=2 SV=1 6 138 4.0E-32
sp|P11118|CALM_EUGGR Calmodulin OS=Euglena gracilis PE=1 SV=2 6 138 4.0E-32
sp|P27163|CALM2_PETHY Calmodulin-2 OS=Petunia hybrida GN=CAM72 PE=2 SV=2 6 138 5.0E-32
sp|O96102|CALM_PHYPO Calmodulin OS=Physarum polycephalum PE=2 SV=3 6 138 5.0E-32
sp|Q6F332|CALM2_ORYSJ Calmodulin-2 OS=Oryza sativa subsp. japonica GN=CAM2 PE=2 SV=3 6 138 6.0E-32
sp|A2Y609|CALM2_ORYSI Calmodulin-2 OS=Oryza sativa subsp. indica GN=CAM2 PE=3 SV=1 6 138 6.0E-32
sp|A8CEP3|CALM_SACJA Calmodulin OS=Saccharina japonica GN=cam PE=2 SV=1 6 138 7.0E-32
sp|O82018|CALM_MOUSC Calmodulin OS=Mougeotia scalaris PE=2 SV=3 6 138 8.0E-32
sp|Q0JNL7|CALM3_ORYSJ Calmodulin-3 OS=Oryza sativa subsp. japonica GN=CAM3 PE=3 SV=1 6 138 1.0E-31
sp|P41040|CALM_MAIZE Calmodulin OS=Zea mays GN=CALM1 PE=2 SV=2 6 138 1.0E-31
sp|Q8X187|CALM_PAXIN Calmodulin OS=Paxillus involutus GN=calA PE=2 SV=3 4 138 2.0E-31
sp|P27166|CALM_STYLE Calmodulin OS=Stylonychia lemnae PE=3 SV=2 6 138 2.0E-31
sp|P84339|CALM_AGABI Calmodulin OS=Agaricus bisporus PE=1 SV=2 4 138 3.0E-31
sp|P0DH96|CALM4_ARATH Calmodulin-4 OS=Arabidopsis thaliana GN=CAM4 PE=1 SV=1 4 138 3.0E-31
sp|P0DH95|CALM1_ARATH Calmodulin-1 OS=Arabidopsis thaliana GN=CAM1 PE=2 SV=1 4 138 3.0E-31
sp|P02597|CALMS_CHICK Calmodulin, striated muscle OS=Gallus gallus GN=CCM1 PE=3 SV=2 6 136 3.0E-31
sp|P02598|CALM_TETPY Calmodulin OS=Tetrahymena pyriformis PE=1 SV=4 6 138 4.0E-31
sp|Q9GRJ1|CALM_LUMRU Calmodulin OS=Lumbricus rubellus PE=2 SV=3 6 138 4.0E-31
sp|Q95NR9|CALM_METSE Calmodulin OS=Metridium senile PE=1 SV=3 6 138 4.0E-31
sp|Q39752|CALM_FAGSY Calmodulin OS=Fagus sylvatica GN=CAMF1 PE=2 SV=3 4 138 4.0E-31
sp|P07463|CALM_PARTE Calmodulin OS=Paramecium tetraurelia GN=CAM PE=1 SV=3 6 138 4.0E-31
sp|P04352|CALM_CHLRE Calmodulin OS=Chlamydomonas reinhardtii PE=1 SV=2 6 138 5.0E-31
sp|P48976|CALM_MALDO Calmodulin OS=Malus domestica GN=CAM PE=3 SV=2 4 138 5.0E-31
sp|P62155|CALM_XENLA Calmodulin OS=Xenopus laevis GN=calm1 PE=1 SV=2 6 138 6.0E-31
sp|P62151|CALM_TORCA Calmodulin OS=Torpedo californica PE=1 SV=2 6 138 6.0E-31
sp|Q6YNX6|CALM_SHEEP Calmodulin OS=Ovis aries GN=CALM2 PE=2 SV=3 6 138 6.0E-31
sp|P62161|CALM_RAT Calmodulin OS=Rattus norvegicus GN=Calm1 PE=1 SV=2 6 138 6.0E-31
sp|P62160|CALM_RABIT Calmodulin OS=Oryctolagus cuniculus GN=CALM PE=1 SV=2 6 138 6.0E-31
sp|Q5RAD2|CALM_PONAB Calmodulin OS=Pongo abelii GN=CALM PE=2 SV=3 6 138 6.0E-31
sp|Q71UH6|CALM_PERFV Calmodulin OS=Perca flavescens GN=calm PE=2 SV=3 6 138 6.0E-31
sp|P62156|CALM_ONCSP Calmodulin OS=Oncorhynchus sp. GN=calm PE=1 SV=2 6 138 6.0E-31
sp|P62204|CALM_MOUSE Calmodulin OS=Mus musculus GN=Calm1 PE=1 SV=2 6 138 6.0E-31
sp|P62158|CALM_HUMAN Calmodulin OS=Homo sapiens GN=CALM1 PE=1 SV=2 6 138 6.0E-31
sp|Q6PI52|CALM_DANRE Calmodulin OS=Danio rerio GN=calm1a PE=2 SV=3 6 138 6.0E-31
sp|Q6IT78|CALM_CTEID Calmodulin OS=Ctenopharyngodon idella GN=calm PE=2 SV=3 6 138 6.0E-31
sp|P62149|CALM_CHICK Calmodulin OS=Gallus gallus GN=CALM PE=1 SV=2 6 138 6.0E-31
sp|P62157|CALM_BOVIN Calmodulin OS=Bos taurus GN=CALM PE=1 SV=2 6 138 6.0E-31
sp|P62144|CALM_ANAPL Calmodulin OS=Anas platyrhynchos GN=CALM PE=2 SV=2 6 138 6.0E-31
sp|Q7T3T2|CALM_EPIAK Calmodulin OS=Epinephelus akaara GN=calm PE=2 SV=3 6 138 6.0E-31
sp|P62184|CALM_RENRE Calmodulin OS=Renilla reniformis PE=1 SV=2 6 138 7.0E-31
sp|O02367|CALM_CIOIN Calmodulin OS=Ciona intestinalis PE=2 SV=3 6 136 8.0E-31
sp|Q9HFY6|CALM_BLAEM Calmodulin OS=Blastocladiella emersonii GN=CMD1 PE=3 SV=3 6 138 9.0E-31
sp|Q9U6D3|CALM_MYXGL Calmodulin OS=Myxine glutinosa PE=2 SV=3 6 138 9.0E-31
sp|O97341|CALM_SUBDO Calmodulin OS=Suberites domuncula PE=2 SV=3 6 133 1.0E-30
sp|Q6R520|CALM_OREMO Calmodulin OS=Oreochromis mossambicus GN=calm PE=2 SV=3 6 138 1.0E-30
sp|P62154|CALM_LOCMI Calmodulin OS=Locusta migratoria PE=1 SV=2 6 133 1.0E-30
sp|P62152|CALM_DROME Calmodulin OS=Drosophila melanogaster GN=Cam PE=1 SV=2 6 133 1.0E-30
sp|P62145|CALM_APLCA Calmodulin OS=Aplysia californica GN=CAM PE=2 SV=2 6 133 1.0E-30
sp|P62153|CALMA_HALRO Calmodulin-A OS=Halocynthia roretzi PE=1 SV=2 6 133 1.0E-30
sp|P62148|CALM1_BRALA Calmodulin-1 OS=Branchiostoma lanceolatum PE=2 SV=2 6 133 1.0E-30
sp|P62147|CALM1_BRAFL Calmodulin-1 OS=Branchiostoma floridae PE=2 SV=2 6 133 1.0E-30
sp|Q9XZP2|CALM2_BRAFL Calmodulin-2 OS=Branchiostoma floridae GN=CAM2 PE=2 SV=4 6 138 1.0E-30
sp|O16305|CALM_CAEEL Calmodulin OS=Caenorhabditis elegans GN=cmd-1 PE=1 SV=3 6 133 1.0E-30
sp|Q9UB37|CALM2_BRALA Calmodulin-2 OS=Branchiostoma lanceolatum GN=CAM2 PE=2 SV=3 6 138 1.0E-30
sp|Q8STF0|CALM_STRIE Calmodulin OS=Strongylocentrotus intermedius PE=2 SV=3 6 133 1.0E-30
sp|P11121|CALM_PYUSP Calmodulin OS=Pyuridae sp. PE=1 SV=2 6 133 2.0E-30
sp|P02594|CALM_ELEEL Calmodulin OS=Electrophorus electricus GN=calm PE=2 SV=2 6 138 2.0E-30
sp|P02595|CALM_PATSP Calmodulin OS=Patinopecten sp. PE=1 SV=2 6 133 2.0E-30
sp|P24044|CALM_PLAFA Calmodulin OS=Plasmodium falciparum PE=3 SV=4 4 138 3.0E-30
sp|P62203|CALM_PLAF7 Calmodulin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0323 PE=3 SV=2 4 138 3.0E-30
sp|P21251|CALM_STIJA Calmodulin OS=Stichopus japonicus PE=1 SV=2 6 133 3.0E-30
sp|P62150|CALM_ORYLA Calmodulin-A (Fragment) OS=Oryzias latipes GN=calm1 PE=2 SV=1 6 133 4.0E-30
sp|P60204|CALM_EMENI Calmodulin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=camA PE=3 SV=2 4 137 5.0E-30
sp|P60205|CALM_ASPOR Calmodulin OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cmdA PE=3 SV=2 4 137 5.0E-30
sp|P60206|CALM_AJECG Calmodulin OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=CAM1 PE=2 SV=2 4 137 5.0E-30
sp|Q95NI4|CALM_HALOK Calmodulin OS=Halichondria okadai PE=2 SV=3 6 133 5.0E-30
sp|P05932|CALMB_ARBPU Calmodulin-beta (Fragment) OS=Arbacia punctulata PE=2 SV=1 6 133 5.0E-30
sp|P15094|CALM_ACHKL Calmodulin OS=Achlya klebsiana GN=CMD1 PE=3 SV=3 6 138 7.0E-30
sp|O96081|CALMB_HALRO Calmodulin-B OS=Halocynthia roretzi PE=3 SV=3 6 133 8.0E-30
sp|P05419|CALN_CHICK Neo-calmodulin (Fragment) OS=Gallus gallus PE=2 SV=1 6 132 9.0E-30
sp|P53440|CALMF_NAEGR Calmodulin, flagellar OS=Naegleria gruberi GN=CAM1 PE=2 SV=1 6 137 1.0E-29
sp|P41041|CALM_PNECA Calmodulin OS=Pneumocystis carinii PE=3 SV=1 4 138 2.0E-29
sp|P62146|CALMA_ARBPU Calmodulin-alpha (Fragment) OS=Arbacia punctulata PE=1 SV=2 6 132 2.0E-29
sp|P61859|CALM_NEUCR Calmodulin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cmd-1 PE=1 SV=2 4 137 2.0E-29
sp|Q9UWF0|CALM_MAGO7 Calmodulin OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CMD1 PE=3 SV=4 4 137 2.0E-29
sp|P61860|CALM_COLTR Calmodulin OS=Colletotrichum trifolii PE=3 SV=2 4 137 2.0E-29
sp|P61861|CALM_COLGL Calmodulin OS=Colletotrichum gloeosporioides PE=2 SV=2 4 137 2.0E-29
sp|P02599|CALM_DICDI Calmodulin OS=Dictyostelium discoideum GN=calA PE=1 SV=3 6 138 3.0E-29
sp|Q40642|CML1_ORYSI Calmodulin-like protein 1 OS=Oryza sativa subsp. indica GN=CML1 PE=1 SV=1 6 139 4.0E-29
sp|Q8S1Y9|CML1_ORYSJ Calmodulin-like protein 1 OS=Oryza sativa subsp. japonica GN=CML1 PE=2 SV=1 6 138 1.0E-28
sp|Q9LIK5|CML11_ARATH Calmodulin-like protein 11 OS=Arabidopsis thaliana GN=CML11 PE=2 SV=1 6 139 6.0E-28
sp|Q9XVI9|MLC5_CAEEL Myosin-2 essential light chain OS=Caenorhabditis elegans GN=mlc-5 PE=1 SV=1 7 137 1.0E-27
sp|P54357|MLC2_DROME Myosin-2 essential light chain OS=Drosophila melanogaster GN=Mlc-c PE=1 SV=1 6 138 3.0E-27
sp|P53141|MLC1_YEAST Myosin light chain 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MLC1 PE=1 SV=1 2 137 8.0E-27
sp|O23320|CML8_ARATH Calmodulin-like protein 8 OS=Arabidopsis thaliana GN=CML8 PE=2 SV=1 4 137 1.0E-26
sp|Q64119|MYL6_RAT Myosin light polypeptide 6 OS=Rattus norvegicus GN=Myl6 PE=1 SV=3 3 137 1.0E-26
sp|Q8CI43|MYL6B_MOUSE Myosin light chain 6B OS=Mus musculus GN=Myl6b PE=1 SV=1 6 138 1.0E-26
sp|P02607|MYL6_CHICK Myosin light polypeptide 6 OS=Gallus gallus GN=MYL6 PE=1 SV=3 3 138 2.0E-26
sp|Q5R844|MYL6_PONAB Myosin light polypeptide 6 OS=Pongo abelii GN=MYL6 PE=2 SV=3 3 138 4.0E-26
sp|P60662|MYL6_PIG Myosin light polypeptide 6 OS=Sus scrofa GN=MYL6 PE=1 SV=2 3 138 4.0E-26
sp|Q60605|MYL6_MOUSE Myosin light polypeptide 6 OS=Mus musculus GN=Myl6 PE=1 SV=3 3 138 4.0E-26
sp|P60660|MYL6_HUMAN Myosin light polypeptide 6 OS=Homo sapiens GN=MYL6 PE=1 SV=2 3 138 4.0E-26
sp|P60661|MYL6_BOVIN Myosin light polypeptide 6 OS=Bos taurus GN=MYL6 PE=2 SV=2 3 138 4.0E-26
sp|A0JNJ5|MYL1_BOVIN Myosin light chain 1/3, skeletal muscle isoform OS=Bos taurus GN=MYL1 PE=2 SV=1 6 139 8.0E-26
sp|P14649|MYL6B_HUMAN Myosin light chain 6B OS=Homo sapiens GN=MYL6B PE=1 SV=1 6 138 1.0E-25
sp|Q0IUU4|CML2_ORYSJ Putative calmodulin-like protein 2 OS=Oryza sativa subsp. japonica GN=CML2 PE=3 SV=2 6 138 3.0E-25
sp|P02606|MLEC_CHICK Myosin light chain 1, cardiac muscle OS=Gallus gallus PE=1 SV=3 6 139 4.0E-25
sp|P49258|CALL_DROME Calmodulin-related protein 97A OS=Drosophila melanogaster GN=Acam PE=1 SV=2 6 136 4.0E-25
sp|P02602|MYL1_RABIT Myosin light chain 1/3, skeletal muscle isoform OS=Oryctolagus cuniculus GN=MYL1 PE=1 SV=3 6 138 4.0E-25
sp|Q7DMP0|CALM2_SOLTU Calmodulin-2/4 (Fragment) OS=Solanum tuberosum GN=PCM2 PE=2 SV=1 19 138 5.0E-25
sp|P02605|MLE3_CHICK Myosin light chain 3, skeletal muscle isoform OS=Gallus gallus PE=1 SV=3 5 138 6.0E-25
sp|P05977|MYL1_MOUSE Myosin light chain 1/3, skeletal muscle isoform OS=Mus musculus GN=Myl1 PE=1 SV=2 5 138 6.0E-25
sp|P02600|MYL1_RAT Myosin light chain 1/3, skeletal muscle isoform OS=Rattus norvegicus GN=Myl1 PE=1 SV=2 6 138 8.0E-25
sp|P02604|MLE1_CHICK Myosin light chain 1, skeletal muscle isoform OS=Gallus gallus PE=1 SV=3 5 138 1.0E-24
sp|P16409|MYL3_RAT Myosin light chain 3 OS=Rattus norvegicus GN=Myl3 PE=1 SV=2 6 139 2.0E-24
sp|P05976|MYL1_HUMAN Myosin light chain 1/3, skeletal muscle isoform OS=Homo sapiens GN=MYL1 PE=2 SV=3 6 138 2.0E-24
sp|P09542|MYL3_MOUSE Myosin light chain 3 OS=Mus musculus GN=Myl3 PE=1 SV=4 6 139 2.0E-24
sp|O00897|CALML_DICDI Calmodulin-like protein OS=Dictyostelium discoideum GN=calB PE=2 SV=1 6 136 3.0E-24
sp|P05933|CALM_SCHPO Calmodulin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cam1 PE=1 SV=1 6 136 3.0E-24
sp|Q0IQB6|CML3_ORYSJ Calmodulin-like protein 3 OS=Oryza sativa subsp. japonica GN=CML3 PE=2 SV=1 6 138 3.0E-24
sp|P09541|MYL4_MOUSE Myosin light chain 4 OS=Mus musculus GN=Myl4 PE=1 SV=3 6 138 4.0E-24
sp|P23286|CALM_CANAX Calmodulin OS=Candida albicans GN=CMD1 PE=3 SV=2 6 138 6.0E-24
sp|Q84MN0|CML4_ORYSJ Calmodulin-like protein 4 OS=Oryza sativa subsp. japonica GN=CML4 PE=2 SV=1 6 133 1.0E-23
sp|P09402|MLE_DICDI Myosin, essential light chain OS=Dictyostelium discoideum GN=mlcE PE=2 SV=2 7 138 1.0E-23
sp|Q41420|CALM3_SOLTU Putative calmodulin-3 (Fragment) OS=Solanum tuberosum GN=PCM3 PE=5 SV=1 19 138 2.0E-23
sp|P82159|MLE1_LIZRA Myosin light chain 1, skeletal muscle isoform OS=Liza ramada PE=1 SV=1 5 138 2.0E-23
sp|Q7Z2B8|MLCD_DICDI Myosin-ID light chain OS=Dictyostelium discoideum GN=mlcD PE=1 SV=1 2 137 2.0E-23
sp|P12829|MYL4_HUMAN Myosin light chain 4 OS=Homo sapiens GN=MYL4 PE=1 SV=3 6 138 2.0E-23
sp|P17209|MYL4_RAT Myosin light chain 4 OS=Rattus norvegicus GN=Myl4 PE=2 SV=2 6 138 2.0E-23
sp|P09540|MLEX_CHICK Myosin light chain, embryonic OS=Gallus gallus PE=2 SV=1 6 138 3.0E-23
sp|P85100|MYL3_BOVIN Myosin light chain 3 OS=Bos taurus GN=MYL3 PE=1 SV=1 6 138 4.0E-23
sp|Q5R887|MYL3_PONAB Myosin light chain 3 OS=Pongo abelii GN=MYL3 PE=2 SV=3 6 139 6.0E-23
sp|P08590|MYL3_HUMAN Myosin light chain 3 OS=Homo sapiens GN=MYL3 PE=1 SV=3 6 139 6.0E-23
sp|P06787|CALM_YEAST Calmodulin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMD1 PE=1 SV=1 6 131 2.0E-22
sp|O60041|CALM_KLULA Calmodulin OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CMD1 PE=1 SV=1 6 131 6.0E-22
sp|Q84VG0|CML7_ORYSJ Probable calcium-binding protein CML7 OS=Oryza sativa subsp. japonica GN=CML7 PE=2 SV=1 4 139 9.0E-22
sp|Q2R1Z5|CML6_ORYSJ Putative calmodulin-like protein 6 OS=Oryza sativa subsp. japonica GN=CML6 PE=3 SV=1 4 138 2.0E-21
sp|Q8VZ50|CML14_ARATH Probable calcium-binding protein CML14 OS=Arabidopsis thaliana GN=CML14 PE=2 SV=1 4 139 4.0E-21
sp|Q94AZ4|CML13_ARATH Probable calcium-binding protein CML13 OS=Arabidopsis thaliana GN=CML13 PE=2 SV=1 4 139 7.0E-21
sp|Q948R0|CML5_ORYSJ Calmodulin-like protein 5 OS=Oryza sativa subsp. japonica GN=CML5 PE=2 SV=1 4 137 4.0E-20
sp|Q17133|MLE_BRAFL Myosin, essential light chain OS=Branchiostoma floridae PE=2 SV=1 7 137 9.0E-20
sp|P53014|MLE_CAEEL Myosin, essential light chain OS=Caenorhabditis elegans GN=mlc-3 PE=3 SV=1 7 138 1.0E-19
sp|P04630|CALL_CAEEL Calmodulin-like protein OS=Caenorhabditis elegans GN=cal-1 PE=3 SV=1 6 136 1.0E-19
sp|P08053|MLR_PHYPO Myosin regulatory light chain OS=Physarum polycephalum PE=1 SV=1 7 137 1.0E-19
sp|P82160|MLE3_LIZRA Myosin light chain 3, skeletal muscle isoform OS=Liza ramada PE=1 SV=1 5 138 5.0E-19
sp|O14008|CAM2_SCHPO Myosin 1 light chain cam2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cam2 PE=1 SV=1 7 138 5.0E-19
sp|P30187|CML10_ARATH Calmodulin-like protein 10 OS=Arabidopsis thaliana GN=CML10 PE=2 SV=1 4 138 3.0E-18
sp|P07462|MLE_HALRO Myosin catalytic light chain, smooth muscle OS=Halocynthia roretzi PE=1 SV=1 4 137 8.0E-17
sp|P10246|TNNC2_MELGA Troponin C, skeletal muscle OS=Meleagris gallopavo GN=TNNC2 PE=1 SV=2 4 136 1.0E-16
sp|Q5XGC7|CALL4_XENTR Calmodulin-like protein 4 OS=Xenopus tropicalis GN=calml4 PE=2 SV=1 2 136 1.0E-16
sp|Q96GE6|CALL4_HUMAN Calmodulin-like protein 4 OS=Homo sapiens GN=CALML4 PE=2 SV=3 6 136 2.0E-16
sp|P02588|TNNC2_CHICK Troponin C, skeletal muscle OS=Gallus gallus GN=TNNC2 PE=1 SV=3 6 136 3.0E-16
sp|P54213|CATR_DUNSA Caltractin OS=Dunaliella salina PE=2 SV=1 7 136 4.0E-16
sp|P43646|CATR_TETST Caltractin (Fragment) OS=Tetraselmis striata PE=2 SV=1 5 136 5.0E-16
sp|Q06827|CATR_SCHDU Caltractin OS=Scherffelia dubia PE=1 SV=1 7 136 8.0E-16
sp|P02589|TNNC2_PELES Troponin C, skeletal muscle OS=Pelophylax esculentus PE=1 SV=1 4 136 1.0E-15
sp|P02587|TNNC2_PIG Troponin C, skeletal muscle OS=Sus scrofa GN=TNNC2 PE=1 SV=2 4 136 2.0E-15
sp|P81660|TNNC2_ANGAN Troponin C, skeletal muscle OS=Anguilla anguilla PE=1 SV=1 6 136 2.0E-15
sp|P14533|CABO_DORPE Squidulin OS=Doryteuthis pealeii PE=1 SV=1 7 136 2.0E-15
sp|Q91WQ9|CALL4_MOUSE Calmodulin-like protein 4 OS=Mus musculus GN=Calml4 PE=1 SV=2 6 136 3.0E-15
sp|P43645|CATR_SPESI Caltractin (Fragment) OS=Spermatozopsis similis PE=2 SV=1 7 136 5.0E-15
sp|P02586|TNNC2_RABIT Troponin C, skeletal muscle OS=Oryctolagus cuniculus GN=TNNC2 PE=1 SV=2 4 136 7.0E-15
sp|Q64122|MYL9_RAT Myosin regulatory light polypeptide 9 OS=Rattus norvegicus GN=Myl9 PE=1 SV=2 6 136 9.0E-15
sp|Q2TBN3|CETN2_BOVIN Centrin-2 OS=Bos taurus GN=CETN2 PE=2 SV=1 7 136 1.0E-14
sp|P53441|CATR_NAEGR Caltractin OS=Naegleria gruberi GN=CTN PE=2 SV=1 7 136 1.0E-14
sp|P02585|TNNC2_HUMAN Troponin C, skeletal muscle OS=Homo sapiens GN=TNNC2 PE=1 SV=2 4 136 2.0E-14
sp|Q3SB11|CALGL_TROCA Calglandulin OS=Tropidechis carinatus PE=2 SV=1 4 136 2.0E-14
sp|P05934|CALM_STRPU Calmodulin (Fragment) OS=Strongylocentrotus purpuratus PE=2 SV=1 68 133 3.0E-14
sp|P20801|TNNC2_MOUSE Troponin C, skeletal muscle OS=Mus musculus GN=Tnnc2 PE=1 SV=2 4 136 4.0E-14
sp|Q9R1K9|CETN2_MOUSE Centrin-2 OS=Mus musculus GN=Cetn2 PE=1 SV=1 7 136 4.0E-14
sp|P41209|CETN1_MOUSE Centrin-1 OS=Mus musculus GN=Cetn1 PE=1 SV=1 7 136 5.0E-14
sp|Q8AY75|CALGL_BOTIN Calglandulin OS=Bothrops insularis PE=2 SV=1 4 136 6.0E-14
sp|Q8K4K1|CETN4_MOUSE Centrin-4 OS=Mus musculus GN=Cetn4 PE=1 SV=1 7 136 6.0E-14
sp|P24032|MLRN_CHICK Myosin regulatory light chain 2, smooth muscle minor isoform OS=Gallus gallus PE=2 SV=2 6 136 7.0E-14
sp|Q3SB13|CALGL_PSETE Calglandulin OS=Pseudonaja textilis PE=2 SV=1 4 136 7.0E-14
sp|Q3SB08|CALGL_PSEPO Calglandulin OS=Pseudechis porphyriacus PE=2 SV=1 4 136 7.0E-14
sp|Q3SB09|CALGL_PSEAU Calglandulin OS=Pseudechis australis PE=2 SV=1 4 136 7.0E-14
sp|Q3SB15|CALGL_OXYSC Calglandulin OS=Oxyuranus scutellatus scutellatus PE=2 SV=1 4 136 7.0E-14
sp|Q3SB14|CALGL_OXYMI Calglandulin OS=Oxyuranus microlepidotus PE=2 SV=1 4 136 7.0E-14
sp|Q3SB12|CALGL_NOTSC Calglandulin OS=Notechis scutatus scutatus PE=2 SV=1 4 136 7.0E-14
sp|Q3SB10|CALGL_HOPST Calglandulin OS=Hoplocephalus stephensii PE=2 SV=1 4 136 7.0E-14
sp|P02612|MLRM_CHICK Myosin regulatory light chain 2, smooth muscle major isoform OS=Gallus gallus PE=1 SV=2 6 136 8.0E-14
sp|Q5RBA4|MYL9_PONAB Myosin regulatory light polypeptide 9 OS=Pongo abelii GN=MYL9 PE=2 SV=3 6 136 8.0E-14
sp|P29269|MYL9_PIG Myosin regulatory light polypeptide 9 OS=Sus scrofa GN=MYL9 PE=1 SV=2 6 136 8.0E-14
sp|P24844|MYL9_HUMAN Myosin regulatory light polypeptide 9 OS=Homo sapiens GN=MYL9 PE=1 SV=4 6 136 8.0E-14
sp|Q9CQ19|MYL9_MOUSE Myosin regulatory light polypeptide 9 OS=Mus musculus GN=Myl9 PE=1 SV=3 6 136 9.0E-14
sp|Q3T0E8|CALL4_BOVIN Calmodulin-like protein 4 OS=Bos taurus GN=CALML4 PE=2 SV=1 6 136 2.0E-13
sp|Q9NZT1|CALL5_HUMAN Calmodulin-like protein 5 OS=Homo sapiens GN=CALML5 PE=1 SV=2 4 136 2.0E-13
sp|P05434|CATR_CHLRE Caltractin OS=Chlamydomonas reinhardtii PE=1 SV=1 7 136 2.0E-13
sp|A4IF97|ML12B_BOVIN Myosin regulatory light chain 12B OS=Bos taurus GN=MYL12B PE=2 SV=1 6 136 3.0E-13
sp|P41208|CETN2_HUMAN Centrin-2 OS=Homo sapiens GN=CETN2 PE=1 SV=1 7 136 4.0E-13
sp|P18666|ML12B_RAT Myosin regulatory light chain 12B OS=Rattus norvegicus GN=Myl12b PE=1 SV=3 6 136 5.0E-13
sp|Q32LE3|CETN1_BOVIN Centrin-1 OS=Bos taurus GN=CETN1 PE=2 SV=1 7 136 5.0E-13
sp|Q3THE2|ML12B_MOUSE Myosin regulatory light chain 12B OS=Mus musculus GN=Myl12b PE=1 SV=2 6 136 6.0E-13
sp|O14950|ML12B_HUMAN Myosin regulatory light chain 12B OS=Homo sapiens GN=MYL12B PE=1 SV=2 6 136 6.0E-13
sp|P07291|MLE_ARGIR Myosin essential light chain, striated adductor muscle OS=Argopecten irradians PE=1 SV=2 5 138 6.0E-13
sp|Q5E9E2|MYL9_BOVIN Myosin regulatory light polypeptide 9 OS=Bos taurus GN=MYL9 PE=2 SV=3 6 136 1.0E-12
sp|Q9JM83|CALM4_MOUSE Calmodulin-4 OS=Mus musculus GN=Calm4 PE=2 SV=2 6 139 1.0E-12
sp|Q5RC34|ML12A_PONAB Myosin regulatory light chain 12A OS=Pongo abelii GN=MYL12A PE=2 SV=3 6 136 1.0E-12
sp|P19105|ML12A_HUMAN Myosin regulatory light chain 12A OS=Homo sapiens GN=MYL12A PE=1 SV=2 6 136 1.0E-12
sp|O82659|CML20_ARATH Probable calcium-binding protein CML20 OS=Arabidopsis thaliana GN=CML20 PE=1 SV=1 7 136 2.0E-12
sp|Q12798|CETN1_HUMAN Centrin-1 OS=Homo sapiens GN=CETN1 PE=1 SV=1 7 136 2.0E-12
sp|P08051|MLR_SPISA Myosin regulatory light chain, smooth muscle OS=Spisula sachalinensis PE=1 SV=1 7 136 2.0E-12
sp|Q09665|TNNC2_CAEEL Troponin C, isoform 2 OS=Caenorhabditis elegans GN=tnc-2 PE=2 SV=1 6 136 3.0E-12
sp|P19123|TNNC1_MOUSE Troponin C, slow skeletal and cardiac muscles OS=Mus musculus GN=Tnnc1 PE=1 SV=1 6 134 3.0E-12
sp|P02591|TNNC1_RABIT Troponin C, slow skeletal and cardiac muscles OS=Oryctolagus cuniculus GN=TNNC1 PE=1 SV=1 6 134 3.0E-12
sp|P63316|TNNC1_HUMAN Troponin C, slow skeletal and cardiac muscles OS=Homo sapiens GN=TNNC1 PE=1 SV=1 6 134 3.0E-12
sp|Q8TD86|CALL6_HUMAN Calmodulin-like protein 6 OS=Homo sapiens GN=CALML6 PE=2 SV=2 6 136 3.0E-12
sp|P07290|MLE_MIZYE Myosin, essential light chain, adductor muscle OS=Mizuhopecten yessoensis PE=1 SV=1 5 138 3.0E-12
sp|P15159|TNNC_TACTR Troponin C OS=Tachypleus tridentatus PE=1 SV=1 7 136 4.0E-12
sp|P63317|TNNC1_PIG Troponin C, slow skeletal and cardiac muscles OS=Sus scrofa GN=TNNC1 PE=1 SV=1 6 134 5.0E-12
sp|P63315|TNNC1_BOVIN Troponin C, slow skeletal and cardiac muscles OS=Bos taurus GN=TNNC1 PE=1 SV=1 6 134 5.0E-12
sp|P13832|MRLCA_RAT Myosin regulatory light chain RLC-A OS=Rattus norvegicus GN=Rlc-a PE=2 SV=2 6 136 6.0E-12
sp|P09860|TNNC1_CHICK Troponin C, slow skeletal and cardiac muscles OS=Gallus gallus GN=TNNC1 PE=1 SV=1 6 134 6.0E-12
sp|P05936|TNNC1_COTJA Troponin C, slow skeletal and cardiac muscles OS=Coturnix coturnix japonica GN=TNNC1 PE=2 SV=1 6 134 2.0E-11
sp|Q9CQ46|EFCB2_MOUSE EF-hand calcium-binding domain-containing protein 2 OS=Mus musculus GN=Efcab2 PE=1 SV=1 7 139 2.0E-11
sp|Q9BLG0|TNNC_TODPA Troponin C OS=Todarodes pacificus PE=1 SV=3 8 137 2.0E-11
sp|Q09510|MLRH_CAEEL Myosin regulatory light chain OS=Caenorhabditis elegans GN=mlc-4 PE=1 SV=1 6 136 3.0E-11
sp|Q9LQN4|CML17_ARATH Probable calcium-binding protein CML17 OS=Arabidopsis thaliana GN=CML17 PE=2 SV=1 7 136 5.0E-11
sp|O74435|CDC31_SCHPO Cell division control protein 31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc31 PE=1 SV=1 8 137 5.0E-11
sp|P40423|SQH_DROME Myosin regulatory light chain sqh OS=Drosophila melanogaster GN=sqh PE=1 SV=1 6 136 6.0E-11
sp|P25071|CML12_ARATH Calmodulin-like protein 12 OS=Arabidopsis thaliana GN=CML12 PE=1 SV=3 4 139 7.0E-11
sp|Q338P8|CML8_ORYSJ Probable calcium-binding protein CML8 OS=Oryza sativa subsp. japonica GN=CML8 PE=2 SV=1 7 136 7.0E-11
sp|Q7F0J0|CML13_ORYSJ Probable calcium-binding protein CML13 OS=Oryza sativa subsp. japonica GN=CML13 PE=2 SV=1 7 136 9.0E-11
sp|Q24956|CATR_GIAIN Caltractin OS=Giardia intestinalis GN=CAL PE=3 SV=1 7 133 9.0E-11
sp|O23184|CML19_ARATH Calcium-binding protein CML19 OS=Arabidopsis thaliana GN=CML19 PE=1 SV=1 7 136 1.0E-10
sp|P08052|MLR_TODPA Myosin regulatory light chain LC-2, mantle muscle OS=Todarodes pacificus PE=1 SV=1 7 133 2.0E-10
sp|Q6F334|CML9_ORYSJ Probable calcium-binding protein CML9 OS=Oryza sativa subsp. japonica GN=CML9 PE=2 SV=1 7 139 2.0E-10
sp|Q9M7R0|ALL8_OLEEU Calcium-binding allergen Ole e 8 OS=Olea europaea PE=1 SV=1 10 136 2.0E-10
sp|P41210|CATR_ATRNU Caltractin OS=Atriplex nummularia PE=2 SV=1 7 136 6.0E-10
sp|P05945|MLE_TODPA Myosin catalytic light chain LC-1, mantle muscle OS=Todarodes pacificus PE=1 SV=2 7 138 9.0E-10
sp|P25071|CML12_ARATH Calmodulin-like protein 12 OS=Arabidopsis thaliana GN=CML12 PE=1 SV=3 4 133 1.0E-09
sp|O35648|CETN3_MOUSE Centrin-3 OS=Mus musculus GN=Cetn3 PE=1 SV=1 7 133 1.0E-09
sp|O15182|CETN3_HUMAN Centrin-3 OS=Homo sapiens GN=CETN3 PE=1 SV=2 7 133 1.0E-09
sp|Q9N1Q9|CABP2_BOVIN Calcium-binding protein 2 OS=Bos taurus GN=CABP2 PE=2 SV=3 9 136 1.0E-09
sp|P35622|TNNC_MIZYE Troponin C OS=Mizuhopecten yessoensis PE=1 SV=1 5 131 1.0E-09
sp|Q9NPB3|CABP2_HUMAN Calcium-binding protein 2 OS=Homo sapiens GN=CABP2 PE=1 SV=4 9 136 1.0E-09
sp|Q9JLK4|CABP2_MOUSE Calcium-binding protein 2 OS=Mus musculus GN=Cabp2 PE=2 SV=3 9 136 2.0E-09
sp|Q3SZE5|MLRV_BOVIN Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Bos taurus GN=MYL2 PE=1 SV=1 6 136 3.0E-09
sp|P80164|MLR_LUMTE Myosin regulatory light chain, striated muscle, 25 kDa isoform OS=Lumbricus terrestris PE=1 SV=1 6 136 4.0E-09
sp|Q7M2V4|MLRV_RABIT Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Oryctolagus cuniculus GN=MYL2 PE=1 SV=2 6 136 4.0E-09
sp|P80322|TNNC_BRALA Troponin C OS=Branchiostoma lanceolatum PE=1 SV=1 4 136 6.0E-09
sp|Q9LX27|CML4_ARATH Calmodulin-like protein 4 OS=Arabidopsis thaliana GN=CML4 PE=2 SV=1 2 136 7.0E-09
sp|P47947|TNNC1_DROME Troponin C, isoform 1 OS=Drosophila melanogaster GN=TpnC41C PE=2 SV=2 7 136 8.0E-09
sp|P29289|TNNC1_HOMAM Troponin C, isoform 1 OS=Homarus americanus PE=1 SV=1 7 136 8.0E-09
sp|P06704|CDC31_YEAST Cell division control protein 31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC31 PE=1 SV=2 8 133 8.0E-09
sp|P10916|MLRV_HUMAN Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Homo sapiens GN=MYL2 PE=1 SV=3 6 136 1.0E-08
sp|P15845|SM20_SCHMA 20 kDa calcium-binding protein OS=Schistosoma mansoni GN=SM20 PE=2 SV=2 7 138 1.0E-08
sp|Q42396|CDPKC_ARATH Calcium-dependent protein kinase 12 OS=Arabidopsis thaliana GN=CPK12 PE=1 SV=1 7 133 2.0E-08
sp|Q9C8Y1|CML23_ARATH Probable calcium-binding protein CML23 OS=Arabidopsis thaliana GN=CML23 PE=2 SV=1 5 139 2.0E-08
sp|P48593|E631_DROME Calcium-binding protein E63-1 OS=Drosophila melanogaster GN=Eip63F-1 PE=2 SV=2 5 137 2.0E-08
sp|Q3SEK0|CATR5_PARTE Caltractin ICL1e OS=Paramecium tetraurelia GN=Icl1e PE=3 SV=1 7 118 3.0E-08
sp|O22845|CML5_ARATH Calmodulin-like protein 5 OS=Arabidopsis thaliana GN=CML5 PE=2 SV=2 7 136 3.0E-08
sp|P08733|MLRV_RAT Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Rattus norvegicus GN=Myl2 PE=1 SV=2 6 136 4.0E-08
sp|P51667|MLRV_MOUSE Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Mus musculus GN=Myl2 PE=1 SV=3 6 136 4.0E-08
sp|O64943|POLC2_JUNOX Polcalcin Jun o 2 OS=Juniperus oxycedrus PE=1 SV=2 7 139 5.0E-08
sp|Q24654|MLC1_DROSI Myosin light chain alkali OS=Drosophila simulans GN=Mlc1 PE=3 SV=3 5 139 6.0E-08
sp|P06742|MLC1_DROME Myosin light chain alkali OS=Drosophila melanogaster GN=Mlc1 PE=1 SV=4 5 139 9.0E-08
sp|Q9N1Q8|CABP5_BOVIN Calcium-binding protein 5 OS=Bos taurus GN=CABP5 PE=1 SV=1 7 136 9.0E-08
sp|Q24621|MLC1_DROPS Myosin light chain alkali OS=Drosophila pseudoobscura pseudoobscura GN=Mlc1 PE=3 SV=1 5 139 9.0E-08
sp|Q09011|CAST_SOLTU Calcium-binding protein CAST OS=Solanum tuberosum PE=2 SV=1 1 138 1.0E-07
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 7 133 1.0E-07
sp|Q9JLK3|CABP5_MOUSE Calcium-binding protein 5 OS=Mus musculus GN=Cabp5 PE=1 SV=1 7 136 1.0E-07
sp|P47948|TNNC2_DROME Troponin C, isoform 2 OS=Drosophila melanogaster GN=TpnC47D PE=2 SV=2 7 136 2.0E-07
sp|P57796|CABP4_HUMAN Calcium-binding protein 4 OS=Homo sapiens GN=CABP4 PE=1 SV=2 9 133 2.0E-07
sp|P13833|MLR_DICDI Myosin regulatory light chain OS=Dictyostelium discoideum GN=mlcR PE=2 SV=1 7 139 3.0E-07
sp|Q9LNE7|CML7_ARATH Calmodulin-like protein 7 OS=Arabidopsis thaliana GN=CML7 PE=2 SV=1 1 132 3.0E-07
sp|Q9LE22|CML27_ARATH Probable calcium-binding protein CML27 OS=Arabidopsis thaliana GN=CML27 PE=1 SV=1 7 136 6.0E-07
sp|P47949|TNNC3_DROME Troponin C, isoform 3 OS=Drosophila melanogaster GN=TpnC73F PE=2 SV=2 7 136 6.0E-07
sp|P25070|CML24_ARATH Calcium-binding protein CML24 OS=Arabidopsis thaliana GN=CML24 PE=2 SV=2 5 136 6.0E-07
sp|Q9ZQE6|CML1_ARATH Calmodulin-like protein 1 OS=Arabidopsis thaliana GN=CML1 PE=2 SV=1 7 139 7.0E-07
sp|P21798|TNNC2_BALNU Troponin C, isoform 2 OS=Balanus nubilus PE=1 SV=2 7 136 9.0E-07
sp|P06706|TNNC_HALRO Troponin C, body wall muscle OS=Halocynthia roretzi PE=1 SV=2 4 133 1.0E-06
sp|Q24756|MLC1_DROVI Myosin light chain alkali OS=Drosophila virilis GN=Mlc1 PE=3 SV=1 5 139 1.0E-06
sp|Q3SEK2|CATR6_PARTE Caltractin ICL1f OS=Paramecium tetraurelia GN=Icl1f PE=3 SV=1 7 122 1.0E-06
sp|P04112|MLRB_MIZYE Myosin regulatory light chain B, smooth adductor muscle OS=Mizuhopecten yessoensis PE=1 SV=1 7 136 1.0E-06
sp|P04113|MLRA_MIZYE Myosin regulatory light chain A, smooth adductor muscle OS=Mizuhopecten yessoensis PE=1 SV=1 7 136 1.0E-06
sp|Q9ZR02|CML6_ARATH Calmodulin-like protein 6 OS=Arabidopsis thaliana GN=CML6 PE=2 SV=1 1 132 1.0E-06
sp|Q9S744|CML9_ARATH Calmodulin-like protein 9 OS=Arabidopsis thaliana GN=CML9 PE=1 SV=1 6 138 1.0E-06
sp|Q6DCF6|EFCB7_XENLA EF-hand calcium-binding domain-containing protein 7 OS=Xenopus laevis GN=efcab7 PE=2 SV=1 22 137 1.0E-06
sp|Q9NP86|CABP5_HUMAN Calcium-binding protein 5 OS=Homo sapiens GN=CABP5 PE=1 SV=1 7 136 1.0E-06
sp|Q9UUG5|MLR1_SCHPO Myosin regulatory light chain 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rlc1 PE=1 SV=1 7 136 2.0E-06
sp|Q9JLK7|CABP1_MOUSE Calcium-binding protein 1 OS=Mus musculus GN=Cabp1 PE=1 SV=3 7 136 2.0E-06
sp|Q9AWK2|CML11_ORYSJ Probable calcium-binding protein CML11 OS=Oryza sativa subsp. japonica GN=CML11 PE=2 SV=1 7 138 2.0E-06
sp|P43187|ALLB3_BETPN Calcium-binding allergen Bet v 3 OS=Betula pendula GN=BETVIII PE=1 SV=1 7 138 3.0E-06
sp|Q9N1R0|CABP1_BOVIN Calcium-binding protein 1 OS=Bos taurus GN=CABP1 PE=1 SV=3 7 136 3.0E-06
sp|Q6L5F4|CML14_ORYSJ Probable calcium-binding protein CML14 OS=Oryza sativa subsp. japonica GN=CML14 PE=2 SV=1 5 136 3.0E-06
sp|Q9SVG9|CML42_ARATH Calcium-binding protein CML42 OS=Arabidopsis thaliana GN=CML42 PE=1 SV=1 10 137 4.0E-06
sp|Q8RZB5|CML10_ORYSJ Probable calcium-binding protein CML10 OS=Oryza sativa subsp. japonica GN=CML10 PE=2 SV=1 10 132 4.0E-06
sp|Q2QVI1|CML28_ORYSJ Probable calcium-binding protein CML28 OS=Oryza sativa subsp. japonica GN=CML28 PE=2 SV=1 1 132 7.0E-06
sp|Q94726|CATR4_PARTE Caltractin ICL1d OS=Paramecium tetraurelia GN=Icl1d PE=3 SV=1 7 129 7.0E-06
sp|Q8VHC5|CABP4_MOUSE Calcium-binding protein 4 OS=Mus musculus GN=Cabp4 PE=1 SV=1 9 133 7.0E-06
sp|Q27178|CATR3_PARTE Caltractin ICL1c OS=Paramecium tetraurelia GN=Icl1c PE=3 SV=1 7 129 7.0E-06
sp|Q27179|CATR2_PARTE Caltractin ICL1b OS=Paramecium tetraurelia GN=Icl1b PE=3 SV=2 7 129 7.0E-06
sp|Q9FZ75|CML15_ARATH Probable calcium-binding protein CML15 OS=Arabidopsis thaliana GN=CML15 PE=2 SV=1 7 136 8.0E-06
sp|Q11083|YT67_CAEEL Uncharacterized calcium-binding protein B0563.7 OS=Caenorhabditis elegans GN=B0563.7 PE=3 SV=1 6 125 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4969
MASTNYKEAFALFDKRGNGRVTVDSLGDLLRACGQNPTLSEIQELEKTAGSEFDFETFQRILNRPGGFRDPGEPE
EYCRGFQVFDKDMTGFIGVGQLKYILTNLGEKMSDDEVDELLKAVDTSSGQVNYTELVRTILAN*
Coding >Hirsu2|4969
ATGGCGTCGACCAACTACAAGGAGGCCTTTGCCCTCTTCGACAAGCGCGGCAACGGCCGCGTCACCGTCGACTCG
CTCGGCGACCTGCTGCGCGCCTGTGGCCAGAACCCGACGCTGTCCGAGATCCAGGAGCTGGAGAAGACGGCCGGG
TCCGAATTCGACTTCGAGACGTTCCAGCGCATCCTCAACCGCCCCGGCGGCTTCCGCGACCCCGGCGAGCCCGAG
GAGTACTGCCGCGGCTTCCAGGTCTTTGACAAGGACATGACGGGCTTCATCGGCGTCGGCCAGCTCAAGTACATC
TTGACGAACCTGGGCGAGAAAATGTCGGACGACGAGGTCGACGAGTTGCTCAAGGCCGTCGACACCAGCTCCGGC
CAGGTCAACTACACGGAACTCGTCCGAACCATCCTCGCCAACTAG
Transcript >Hirsu2|4969
ATGGCGTCGACCAACTACAAGGAGGCCTTTGCCCTCTTCGACAAGCGCGGCAACGGCCGCGTCACCGTCGACTCG
CTCGGCGACCTGCTGCGCGCCTGTGGCCAGAACCCGACGCTGTCCGAGATCCAGGAGCTGGAGAAGACGGCCGGG
TCCGAATTCGACTTCGAGACGTTCCAGCGCATCCTCAACCGCCCCGGCGGCTTCCGCGACCCCGGCGAGCCCGAG
GAGTACTGCCGCGGCTTCCAGGTCTTTGACAAGGACATGACGGGCTTCATCGGCGTCGGCCAGCTCAAGTACATC
TTGACGAACCTGGGCGAGAAAATGTCGGACGACGAGGTCGACGAGTTGCTCAAGGCCGTCGACACCAGCTCCGGC
CAGGTCAACTACACGGAACTCGTCCGAACCATCCTCGCCAACTAG
Gene >Hirsu2|4969
ATGGTGAGTTGCCCCAGCACCGGCGGCTGAGCAGTAAACAAACGAGCCCCGCGACCACATGATTCGCCAGCAGCC
GCCGCCGCCTCGCCCTTTGCCCATCGCCCTTCTTCCGCACACGGCGAGTCTCGGTGCGATAGCGTGAGCAAAGCT
GCACAACGCACCACATCGCATCCCCTGCCTTCGCCTCGCTTGCATCTCTGCACGAACCCACCGCCGCAGCGACCC
CGTGCTCGGACCGAGAGGAGAGGAAAAACAAAGAGAAGAAACATGTCTTCTAACCAGTACGAGTCCCAGGCGTCG
ACCAACTACAAGGAGGCCTTTGCCCTCTTCGACAAGCGCGGCAACGGCCGCGTCACCGTCGACTCGCTCGGCGAC
CTGCTGCGCGCCTGTGGCCAGAACCCGACGCTGTCCGAGATCCAGGAGCTGGAGAAGACGGCCGGGTCCGAATGT
GAGTGGTGCGGGAGAGGAGGCCGAGGGGGGAGAGAGGGTGCTGACGACGATTGGCAGTCGACTTCGAGACGTTCC
AGCGCATCCTCAACCGCCCCGGCGGCTTCCGCGACCCCGGCGAGCCCGAGGAGTACTGCCGCGGCTTCCAGGTCT
TTGACAAGGACATGACGGGCTTCATCGGCGTCGGCCAGCTCAAGTACATCTTGACGAACCTGGGCGAGAAAATGT
CGGACGACGAGGTCGACGAGTTGCTCAAGGCCGTCGACACCAGCTCCGGCCAGGTCAACTACACGGGTAGGGAGA
CGCGCCCGCCCCCTGTTGCGTGCTGTGTGCTTTTTGCTGACAATGGCCTTGCGCCCTTCAGAACTCGTCCGAACC
ATCCTCGCCAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail