Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4964
Gene name
LocationContig_25:636..2592
Strand-
Gene length (bp)1956
Transcript length (bp)1413
Coding sequence length (bp)1413
Protein length (aa) 471

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00002 7tm_2 7 transmembrane receptor (Secretin family) 1.1E-08 26 201

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q54U75|CRLA_DICDI Cyclic AMP receptor-like protein A OS=Dictyostelium discoideum GN=crlA PE=2 SV=1 7 214 5.0E-10

GO

GO Term Description Terminal node
GO:0004930 G protein-coupled receptor activity Yes
GO:0016021 integral component of membrane Yes
GO:0007186 G protein-coupled receptor signaling pathway Yes
GO:0008150 biological_process No
GO:0065007 biological regulation No
GO:0038023 signaling receptor activity No
GO:0004888 transmembrane signaling receptor activity No
GO:0003674 molecular_function No
GO:0060089 molecular transducer activity No
GO:0044425 membrane part No
GO:0050794 regulation of cellular process No
GO:0007165 signal transduction No
GO:0005575 cellular_component No
GO:0009987 cellular process No
GO:0050789 regulation of biological process No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.5

Transmembrane Domains

Domain # Start End Length
1 30 52 22
2 59 78 19
3 105 124 19
4 131 153 22
5 180 202 22
6 335 354 19
7 369 391 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4964
MALPPPESWPPTADDFTKRQNGILVTLERVGGSISLIALMFIFIAYALFRPVRNVQNTFIVFASVSNVGASIASI
IALDGLHAGKSTALCQTQSFLFEMFMQSDPWWSLAMAINVFLVFYFRTSPDSFRRWWWLYCLICYGGPFVIALAL
LFVKNQQRGSVYGQATIWCWVDVKWDSIRIYTYYMLIWICIVGSFVCYILVGYHVFRTRNQLHSFSASRSREAGP
YERAAACHEAARDEGCYGTVTTEVHIIHSSASTACQPVLEPKPAHLSRDRQASFNASPAPDRHGAPAQYYSTVTS
AAPRRARLMSPLDKLVRSIRRAASRFVIDDPVKRAYLRTSLLFALSVLVTWIPSSLNRINSWLNSASPYEFHVAT
AAVLPLQGLWNFLIFFVTSWRVVRRCVGVGGRSADWPRDDDTLDRAAAPGRERHGPGDDGRSETDGEDVESGNMG
SDVELRRVRDDGERKARAGA*
Coding >Hirsu2|4964
ATGGCTCTCCCGCCGCCGGAGAGCTGGCCGCCCACCGCGGACGACTTCACCAAGAGGCAGAACGGCATTCTCGTC
ACGCTCGAGCGCGTCGGCGGCTCCATCAGCCTGATCGCCCTCATGTTCATCTTCATCGCCTACGCCTTGTTTCGC
CCCGTCCGGAACGTGCAGAATACCTTCATCGTCTTCGCCAGCGTCTCCAACGTCGGAGCCAGCATCGCGAGCATC
ATCGCCCTCGATGGCCTGCACGCCGGCAAGAGCACGGCCCTATGCCAGACGCAGAGCTTCCTCTTTGAGATGTTC
ATGCAGTCCGACCCATGGTGGTCTCTGGCCATGGCCATCAACGTCTTTCTCGTCTTCTACTTCCGCACCAGCCCC
GACTCTTTCCGCCGCTGGTGGTGGCTGTACTGTCTCATCTGCTACGGCGGGCCCTTCGTCATTGCCCTGGCCTTG
CTGTTCGTCAAGAACCAGCAGCGCGGCTCGGTCTATGGCCAGGCAACGATATGGTGCTGGGTCGACGTGAAGTGG
GACAGCATCCGCATCTACACATACTACATGCTGATCTGGATCTGCATCGTCGGCTCCTTCGTCTGCTACATCTTG
GTCGGCTATCACGTCTTCCGCACGCGGAACCAGCTCCACAGCTTCTCGGCCTCGAGAAGCCGCGAGGCCGGCCCT
TACGAACGGGCTGCCGCGTGCCATGAAGCCGCCAGAGACGAGGGCTGCTACGGGACCGTCACCACCGAAGTCCAC
ATCATACACAGCTCGGCCTCGACGGCGTGCCAGCCCGTACTCGAGCCCAAGCCGGCCCACCTCTCGCGCGACAGG
CAGGCCTCGTTCAACGCCAGCCCGGCGCCCGACAGGCACGGCGCGCCCGCGCAGTACTACTCGACGGTGACGTCG
GCCGCGCCCCGTCGCGCCAGGCTCATGTCGCCCCTGGACAAGCTCGTGCGGTCGATCCGGCGGGCCGCTTCCCGC
TTCGTTATCGACGACCCGGTCAAGCGCGCCTACCTGCGCACGAGCCTGCTCTTCGCCCTCAGCGTGCTCGTCACC
TGGATCCCCAGCAGCCTCAACCGCATCAACAGCTGGCTCAACAGCGCGTCGCCGTACGAGTTCCACGTGGCGACG
GCGGCGGTGCTGCCGCTGCAGGGCCTGTGGAACTTCCTCATCTTCTTCGTCACCAGCTGGCGGGTGGTCAGGCGC
TGCGTCGGCGTTGGCGGCCGGTCGGCCGACTGGCCGCGCGACGACGACACGCTCGACCGGGCCGCGGCCCCGGGG
CGGGAGCGTCACGGGCCCGGCGACGACGGCCGGTCCGAGACGGACGGCGAGGACGTCGAGTCGGGCAACATGGGC
AGCGACGTGGAGCTGCGGCGCGTGCGGGACGACGGCGAGCGCAAGGCGAGGGCCGGCGCGTGA
Transcript >Hirsu2|4964
ATGGCTCTCCCGCCGCCGGAGAGCTGGCCGCCCACCGCGGACGACTTCACCAAGAGGCAGAACGGCATTCTCGTC
ACGCTCGAGCGCGTCGGCGGCTCCATCAGCCTGATCGCCCTCATGTTCATCTTCATCGCCTACGCCTTGTTTCGC
CCCGTCCGGAACGTGCAGAATACCTTCATCGTCTTCGCCAGCGTCTCCAACGTCGGAGCCAGCATCGCGAGCATC
ATCGCCCTCGATGGCCTGCACGCCGGCAAGAGCACGGCCCTATGCCAGACGCAGAGCTTCCTCTTTGAGATGTTC
ATGCAGTCCGACCCATGGTGGTCTCTGGCCATGGCCATCAACGTCTTTCTCGTCTTCTACTTCCGCACCAGCCCC
GACTCTTTCCGCCGCTGGTGGTGGCTGTACTGTCTCATCTGCTACGGCGGGCCCTTCGTCATTGCCCTGGCCTTG
CTGTTCGTCAAGAACCAGCAGCGCGGCTCGGTCTATGGCCAGGCAACGATATGGTGCTGGGTCGACGTGAAGTGG
GACAGCATCCGCATCTACACATACTACATGCTGATCTGGATCTGCATCGTCGGCTCCTTCGTCTGCTACATCTTG
GTCGGCTATCACGTCTTCCGCACGCGGAACCAGCTCCACAGCTTCTCGGCCTCGAGAAGCCGCGAGGCCGGCCCT
TACGAACGGGCTGCCGCGTGCCATGAAGCCGCCAGAGACGAGGGCTGCTACGGGACCGTCACCACCGAAGTCCAC
ATCATACACAGCTCGGCCTCGACGGCGTGCCAGCCCGTACTCGAGCCCAAGCCGGCCCACCTCTCGCGCGACAGG
CAGGCCTCGTTCAACGCCAGCCCGGCGCCCGACAGGCACGGCGCGCCCGCGCAGTACTACTCGACGGTGACGTCG
GCCGCGCCCCGTCGCGCCAGGCTCATGTCGCCCCTGGACAAGCTCGTGCGGTCGATCCGGCGGGCCGCTTCCCGC
TTCGTTATCGACGACCCGGTCAAGCGCGCCTACCTGCGCACGAGCCTGCTCTTCGCCCTCAGCGTGCTCGTCACC
TGGATCCCCAGCAGCCTCAACCGCATCAACAGCTGGCTCAACAGCGCGTCGCCGTACGAGTTCCACGTGGCGACG
GCGGCGGTGCTGCCGCTGCAGGGCCTGTGGAACTTCCTCATCTTCTTCGTCACCAGCTGGCGGGTGGTCAGGCGC
TGCGTCGGCGTTGGCGGCCGGTCGGCCGACTGGCCGCGCGACGACGACACGCTCGACCGGGCCGCGGCCCCGGGG
CGGGAGCGTCACGGGCCCGGCGACGACGGCCGGTCCGAGACGGACGGCGAGGACGTCGAGTCGGGCAACATGGGC
AGCGACGTGGAGCTGCGGCGCGTGCGGGACGACGGCGAGCGCAAGGCGAGGGCCGGCGCGTGA
Gene >Hirsu2|4964
ATGGCTCTCCCGCCGCCGGAGAGCTGGCCGCCCACCGCGGACGACTTCACCAAGAGGCAGAACGGCATTCTCGTC
ACGCTCGAGCGCGTCGGCGGCTCCATCAGCCTGATCGCCCTCATGTTCATCTTCATCGCCTACGCCTTGTTTCGC
CCCGTCCGGAACGTGCAGAATACCTTCATCGTCTTCGCCAGCGTCTCCAACGTCGGAGCCAGCATCGCGAGCATC
ATCGCCCTCGATGGCCTGCACGCCGGCAAGAGCACGGCCCTATGCCAGACGCAGAGCTTCCTCTTTGAGATGTCA
GTTAATTTTCGTGACCCTTCGGCTGCTCTTTCATCCCATGTGCCCTTCTATCCTCCCACCCTCTCCGTCTCTCAC
TTCTTGACACCCTCGGCCTCTTCGGGCGACCTGCTTTTCCCGTCACAACTTTCCTCCTCTGCGGTGTACGTCATA
AGGCTTGGAGCAAACGAAAACAGCCGCAACGGCCATCAAACGCGAAAAGGGAAATCAGAAGCCCGCGCAAGATGC
CAATGAAACCATGGCTTTTCCCAGCAACAGATTCTCTCAGTCCCCGACCTTGGCGAATCAACACCATGCACTCGC
TGCGCTCGCCCGAAATGGAGCAGACGGAAAGCAAAGTCACGGGCTGATACCGTCTCCAGGTTCATGCAGTCCGAC
CCATGGTGGTCTCTGGCCATGGCCATCAACGTCTTTCTCGTCTTCTACTTCCGCACCAGCCCCGACTCTTTCCGC
CGCTGGTGGTGGCTGTACTGTCTCATCTGCTACGGCGGGCCCTTCGTCATTGCCCTGGCCTTGCTGTTCGTCAAG
AACCAGCAGCGCGGCTCGGTCTATGGCCAGGCAACGGTGCGTCACTCGTCGACCCTGCTCCGGGAGGCAACCTCC
GCAACGGCTCGTCGAGCGCTGATATGGACGACGAGGGCAGATATGGTGCTGGGTCGACGTGAAGTGGGACAGCAT
CCGCATCTACACATACTACATGCTGATCTGGATCTGCATCGTCGGCTCCTTCGTCTGCTACATCTTGGTCGGCTA
TCACGTCTTCCGCACGCGGAACCAGCTCCACAGCTTCTCGGCCTCGAGAAGCCGCGAGGCCGGCCCTTACGAACG
GGTACGGTACCCGGCAGCCCGTGCCCCCAAGCCCCCCCGCCCCTTTCCCTCTCGCCGTGCCGGCCGGCGGCTGAC
GACAGCTGGCAATGCGCCCCGAGGCAGGCTGCCGCGTGCCATGAAGCCGCCAGAGACGAGGGCTGCTACGGGACC
GTCACCACCGAAGTCCACATCATACACAGCTCGGCCTCGACGGCGTGCCAGCCCGTACTCGAGCCCAAGCCGGCC
CACCTCTCGCGCGACAGGCAGGCCTCGTTCAACGCCAGCCCGGCGCCCGACAGGCACGGCGCGCCCGCGCAGTAC
TACTCGACGGTGACGTCGGCCGCGCCCCGTCGCGCCAGGCTCATGTCGCCCCTGGACAAGCTCGTGCGGTCGATC
CGGCGGGCCGCTTCCCGCTTCGTTATCGACGACCCGGTCAAGCGCGCCTACCTGCGCACGAGCCTGCTCTTCGCC
CTCAGCGTGCTCGTCACCTGGATCCCCAGCAGCCTCAACCGCATCAACAGCTGGCTCAACAGCGCGTCGCCGTAC
GAGTTCCACGTGGCGACGGCGGCGGTGCTGCCGCTGCAGGGCCTGTGGAACTTCCTCATCTTCTTCGTCACCAGC
TGGCGGGTGGTCAGGCGCTGCGTCGGCGTTGGCGGCCGGTCGGCCGACTGGCCGCGCGACGACGACACGCTCGAC
CGGGCCGCGGCCCCGGGGCGGGAGCGTCACGGGCCCGGCGACGACGGCCGGTCCGAGACGGACGGCGAGGACGTC
GAGTCGGGCAACATGGGCAGCGACGTGGAGCTGCGGCGCGTGCGGGACGACGGCGAGCGCAAGGCGAGGGCCGGC
GCGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail