Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4956
Gene name
LocationContig_2492:45..1437
Strand-
Gene length (bp)1392
Transcript length (bp)1305
Coding sequence length (bp)1305
Protein length (aa) 435

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04185 Phosphoesterase Phosphoesterase family 3.7E-27 84 318

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8X176|PHOA_ASPFU Acid phosphatase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=phoA PE=1 SV=1 8 338 1.0E-111
sp|P08540|PHOX_KLULA Probable acid phosphatase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0B14839g PE=4 SV=2 43 403 7.0E-110
sp|P37274|PHOA_PENCH Phosphate-repressible acid phosphatase OS=Penicillium chrysogenum GN=PHOA PE=1 SV=1 41 348 3.0E-99
sp|P34724|PHOA_ASPNG Acid phosphatase OS=Aspergillus niger GN=phoA PE=1 SV=1 4 348 2.0E-92

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4956
MVLLLLHASLVALVGLVGGCRAGNDKGTDGWETRYTETATAVVEASAATAVTKSPVSHVGGKAFDRLAIIFFENQ
NFEKARGDPNFAWLATKGVALTNYYGVTHPSQPNYMASVAGDYFGMNHDDFSRAPRSVATVMDLLDERGIAWGLY
QEDMPFSGFEGGAWVNRDNGANDYVRKHNPAVLHDSVATWEGRLAQIKNLSLARPGESAFHMDLAARRLPQWMFI
TPNMTSDGHDTSVTHAGRWARHFLEPLLDDGRFMDRTLVLVTWDESETYAARNRVLGLLLGDAVPPELVGSQDDH
FYTHYSQISSVSANWDLPTLGRWDVGANVFQFVGAKTGDTPRRFPSETALQARYWNVSYNGYFHTAGADGLGNGA
KGIPSPNLALDRNTHNRRPILASVRDTWSKNPDGASTYYADIIDVPDGLQPPQGWAPDP*
Coding >Hirsu2|4956
ATGGTCCTCCTCCTCCTCCACGCCAGCCTCGTGGCCCTGGTCGGCCTCGTCGGCGGCTGCAGGGCCGGCAACGAC
AAGGGCACGGACGGGTGGGAGACGCGATACACGGAGACGGCCACGGCCGTGGTCGAGGCGTCGGCGGCGACGGCC
GTGACGAAAAGCCCCGTCAGCCATGTCGGCGGCAAGGCCTTTGACCGGCTGGCCATCATCTTCTTCGAGAACCAG
AATTTCGAAAAGGCGCGGGGCGACCCCAACTTCGCCTGGCTCGCGACCAAGGGCGTCGCCCTGACCAACTACTAC
GGCGTCACGCACCCGTCGCAGCCCAACTACATGGCCTCGGTGGCGGGCGACTACTTCGGCATGAACCACGACGAC
TTCAGCCGGGCGCCGCGCAGCGTGGCGACCGTCATGGACCTGCTGGACGAGCGCGGCATCGCCTGGGGCCTCTAC
CAGGAGGACATGCCCTTCTCCGGCTTCGAGGGCGGCGCCTGGGTCAACCGCGACAACGGCGCCAACGACTACGTG
CGCAAGCACAACCCGGCCGTCCTGCACGACAGCGTCGCCACCTGGGAGGGCCGCCTGGCCCAGATCAAGAACCTG
TCGCTGGCCCGGCCGGGCGAGTCGGCCTTCCACATGGACCTGGCCGCCCGCCGGCTGCCGCAGTGGATGTTCATC
ACGCCCAACATGACGTCCGACGGCCACGACACGTCCGTCACCCACGCCGGCCGCTGGGCCCGCCACTTCCTCGAG
CCGCTGCTCGACGACGGCCGCTTCATGGACCGCACCCTCGTCCTCGTCACCTGGGACGAGAGCGAGACGTACGCG
GCCCGCAACCGCGTCCTCGGCCTGCTGCTCGGCGACGCCGTCCCGCCCGAGCTGGTCGGCAGCCAGGACGACCAC
TTCTACACCCACTACTCGCAGATCAGCTCCGTCTCCGCCAACTGGGACCTGCCCACCCTCGGCCGCTGGGACGTC
GGCGCCAACGTCTTCCAGTTCGTCGGCGCCAAGACGGGCGACACCCCGCGCCGCTTCCCCTCCGAGACGGCCCTT
CAGGCCCGATACTGGAACGTGTCCTACAACGGCTACTTCCACACCGCCGGCGCCGACGGCCTCGGCAACGGCGCC
AAGGGCATCCCCTCGCCCAACCTCGCCCTCGACCGCAACACCCACAACCGCCGCCCCATCCTGGCCAGCGTCCGC
GACACCTGGTCCAAGAATCCGGACGGCGCCTCGACCTACTACGCCGATATCATCGACGTGCCCGACGGCCTGCAG
CCGCCCCAGGGCTGGGCACCCGACCCGTGA
Transcript >Hirsu2|4956
ATGGTCCTCCTCCTCCTCCACGCCAGCCTCGTGGCCCTGGTCGGCCTCGTCGGCGGCTGCAGGGCCGGCAACGAC
AAGGGCACGGACGGGTGGGAGACGCGATACACGGAGACGGCCACGGCCGTGGTCGAGGCGTCGGCGGCGACGGCC
GTGACGAAAAGCCCCGTCAGCCATGTCGGCGGCAAGGCCTTTGACCGGCTGGCCATCATCTTCTTCGAGAACCAG
AATTTCGAAAAGGCGCGGGGCGACCCCAACTTCGCCTGGCTCGCGACCAAGGGCGTCGCCCTGACCAACTACTAC
GGCGTCACGCACCCGTCGCAGCCCAACTACATGGCCTCGGTGGCGGGCGACTACTTCGGCATGAACCACGACGAC
TTCAGCCGGGCGCCGCGCAGCGTGGCGACCGTCATGGACCTGCTGGACGAGCGCGGCATCGCCTGGGGCCTCTAC
CAGGAGGACATGCCCTTCTCCGGCTTCGAGGGCGGCGCCTGGGTCAACCGCGACAACGGCGCCAACGACTACGTG
CGCAAGCACAACCCGGCCGTCCTGCACGACAGCGTCGCCACCTGGGAGGGCCGCCTGGCCCAGATCAAGAACCTG
TCGCTGGCCCGGCCGGGCGAGTCGGCCTTCCACATGGACCTGGCCGCCCGCCGGCTGCCGCAGTGGATGTTCATC
ACGCCCAACATGACGTCCGACGGCCACGACACGTCCGTCACCCACGCCGGCCGCTGGGCCCGCCACTTCCTCGAG
CCGCTGCTCGACGACGGCCGCTTCATGGACCGCACCCTCGTCCTCGTCACCTGGGACGAGAGCGAGACGTACGCG
GCCCGCAACCGCGTCCTCGGCCTGCTGCTCGGCGACGCCGTCCCGCCCGAGCTGGTCGGCAGCCAGGACGACCAC
TTCTACACCCACTACTCGCAGATCAGCTCCGTCTCCGCCAACTGGGACCTGCCCACCCTCGGCCGCTGGGACGTC
GGCGCCAACGTCTTCCAGTTCGTCGGCGCCAAGACGGGCGACACCCCGCGCCGCTTCCCCTCCGAGACGGCCCTT
CAGGCCCGATACTGGAACGTGTCCTACAACGGCTACTTCCACACCGCCGGCGCCGACGGCCTCGGCAACGGCGCC
AAGGGCATCCCCTCGCCCAACCTCGCCCTCGACCGCAACACCCACAACCGCCGCCCCATCCTGGCCAGCGTCCGC
GACACCTGGTCCAAGAATCCGGACGGCGCCTCGACCTACTACGCCGATATCATCGACGTGCCCGACGGCCTGCAG
CCGCCCCAGGGCTGGGCACCCGACCCGTGA
Gene >Hirsu2|4956
ATGGTCCTCCTCCTCCTCCACGCCAGCCTCGTGGCCCTGGTCGGCCTCGTCGGCGGCTGCAGGGCCGGCAACGAC
AAGGGCACGGACGGGTGGGAGACGCGATACACGGAGACGGCCACGGCCGTGGTCGAGGCGTCGGCGGCGACGGCC
GTGACGAAAAGCCCCGTCAGCCATGTCGGCGGCAAGGCCTTTGACCGGCTGGCCATCATCTTCTTCGAGAACCAG
AATTTCGAAAAGGCGCGGGGCGACCGTGAGTCGTCTCTCTCTCATGTCTCTCCTTGTATCTTGCCGGCTGACCAT
CATCCATCATCGTCGGTCCGTCCGGTCCGCCGTGCAGCCAACTTCGCCTGGCTCGCGACCAAGGGCGTCGCCCTG
ACCAACTACTACGGCGTCACGCACCCGTCGCAGCCCAACTACATGGCCTCGGTGGCGGGCGACTACTTCGGCATG
AACCACGACGACTTCAGCCGGGCGCCGCGCAGCGTGGCGACCGTCATGGACCTGCTGGACGAGCGCGGCATCGCC
TGGGGCCTCTACCAGGAGGACATGCCCTTCTCCGGCTTCGAGGGCGGCGCCTGGGTCAACCGCGACAACGGCGCC
AACGACTACGTGCGCAAGCACAACCCGGCCGTCCTGCACGACAGCGTCGCCACCTGGGAGGGCCGCCTGGCCCAG
ATCAAGAACCTGTCGCTGGCCCGGCCGGGCGAGTCGGCCTTCCACATGGACCTGGCCGCCCGCCGGCTGCCGCAG
TGGATGTTCATCACGCCCAACATGACGTCCGACGGCCACGACACGTCCGTCACCCACGCCGGCCGCTGGGCCCGC
CACTTCCTCGAGCCGCTGCTCGACGACGGCCGCTTCATGGACCGCACCCTCGTCCTCGTCACCTGGGACGAGAGC
GAGACGTACGCGGCCCGCAACCGCGTCCTCGGCCTGCTGCTCGGCGACGCCGTCCCGCCCGAGCTGGTCGGCAGC
CAGGACGACCACTTCTACACCCACTACTCGCAGATCAGCTCCGTCTCCGCCAACTGGGACCTGCCCACCCTCGGC
CGCTGGGACGTCGGCGCCAACGTCTTCCAGTTCGTCGGCGCCAAGACGGGCGACACCCCGCGCCGCTTCCCCTCC
GAGACGGCCCTTCAGGCCCGATACTGGAACGTGTCCTACAACGGCTACTTCCACACCGCCGGCGCCGACGGCCTC
GGCAACGGCGCCAAGGGCATCCCCTCGCCCAACCTCGCCCTCGACCGCAACACCCACAACCGCCGCCCCATCCTG
GCCAGCGTCCGCGACACCTGGTCCAAGAATCCGGACGGCGCCTCGACCTACTACGCCGATATCATCGACGTGCCC
GACGGCCTGCAGCCGCCCCAGGGCTGGGCACCCGACCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail