Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4953
Gene name
LocationContig_2490:81..414
Strand+
Gene length (bp)333
Transcript length (bp)333
Coding sequence length (bp)333
Protein length (aa) 111

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00171 Aldedh Aldehyde dehydrogenase family 3.4E-34 1 99

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US47|SSDH1_SCHPO Putative succinate-semialdehyde dehydrogenase C1002.12c [NADP(+)] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.12c PE=3 SV=2 1 104 2.0E-40
sp|Q88RC0|DAVD_PSEPK Glutarate-semialdehyde dehydrogenase DavD OS=Pseudomonas putida (strain KT2440) GN=davD PE=3 SV=1 2 97 2.0E-35
sp|Q9I6M5|DAVD_PSEAE Glutarate-semialdehyde dehydrogenase DavD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=davD PE=1 SV=1 3 104 2.0E-34
sp|P51650|SSDH_RAT Succinate-semialdehyde dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Aldh5a1 PE=1 SV=2 1 104 3.0E-34
sp|P25526|GABD_ECOLI Succinate-semialdehyde dehydrogenase [NADP(+)] GabD OS=Escherichia coli (strain K12) GN=gabD PE=1 SV=1 3 102 1.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US47|SSDH1_SCHPO Putative succinate-semialdehyde dehydrogenase C1002.12c [NADP(+)] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.12c PE=3 SV=2 1 104 2.0E-40
sp|Q88RC0|DAVD_PSEPK Glutarate-semialdehyde dehydrogenase DavD OS=Pseudomonas putida (strain KT2440) GN=davD PE=3 SV=1 2 97 2.0E-35
sp|Q9I6M5|DAVD_PSEAE Glutarate-semialdehyde dehydrogenase DavD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=davD PE=1 SV=1 3 104 2.0E-34
sp|P51650|SSDH_RAT Succinate-semialdehyde dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Aldh5a1 PE=1 SV=2 1 104 3.0E-34
sp|P25526|GABD_ECOLI Succinate-semialdehyde dehydrogenase [NADP(+)] GabD OS=Escherichia coli (strain K12) GN=gabD PE=1 SV=1 3 102 1.0E-33
sp|Q8BWF0|SSDH_MOUSE Succinate-semialdehyde dehydrogenase, mitochondrial OS=Mus musculus GN=Aldh5a1 PE=1 SV=1 1 104 4.0E-33
sp|P38067|UGA2_YEAST Succinate-semialdehyde dehydrogenase [NADP(+)] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UGA2 PE=1 SV=2 3 104 3.0E-31
sp|P55653|GABD_RHISN Probable succinate-semialdehyde dehydrogenase [NADP(+)] OS=Rhizobium sp. (strain NGR234) GN=gabD PE=3 SV=1 1 104 4.0E-31
sp|B9F3B6|SSDH_ORYSJ Succinate-semialdehyde dehydrogenase, mitochondrial OS=Oryza sativa subsp. japonica GN=ALDH5F1 PE=3 SV=1 1 104 8.0E-31
sp|Q8GAI8|SSDH_ARTNI Succinate-semialdehyde dehydrogenase OS=Arthrobacter nicotinovorans GN=sad PE=1 SV=1 2 110 1.0E-30
sp|Q6A2H2|SSDH_PONPY Succinate-semialdehyde dehydrogenase, mitochondrial OS=Pongo pygmaeus GN=ALDH5A1 PE=2 SV=2 1 104 8.0E-30
sp|Q3MSM4|SSDH_PANPA Succinate-semialdehyde dehydrogenase, mitochondrial OS=Pan paniscus GN=ALDH5A1 PE=2 SV=1 1 104 1.0E-29
sp|Q6A2H1|SSDH_GORGO Succinate-semialdehyde dehydrogenase, mitochondrial OS=Gorilla gorilla gorilla GN=ALDH5A1 PE=2 SV=1 1 104 1.0E-29
sp|Q6A2H0|SSDH_PANTR Succinate-semialdehyde dehydrogenase, mitochondrial OS=Pan troglodytes GN=ALDH5A1 PE=2 SV=1 1 104 1.0E-29
sp|Q3MSM3|SSDH_HYLLA Succinate-semialdehyde dehydrogenase, mitochondrial OS=Hylobates lar GN=ALDH5A1 PE=2 SV=1 1 104 1.0E-29
sp|P51649|SSDH_HUMAN Succinate-semialdehyde dehydrogenase, mitochondrial OS=Homo sapiens GN=ALDH5A1 PE=1 SV=2 1 104 1.0E-29
sp|Q9SAK4|SSDH_ARATH Succinate-semialdehyde dehydrogenase, mitochondrial OS=Arabidopsis thaliana GN=ALDH5F1 PE=1 SV=2 1 104 3.0E-29
sp|Q9UTM8|SSDH2_SCHPO Putative succinate-semialdehyde dehydrogenase C139.05 [NADP(+)] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC139.05 PE=3 SV=1 1 100 2.0E-25
sp|P42757|BADH_ATRHO Betaine aldehyde dehydrogenase, chloroplastic OS=Atriplex hortensis PE=2 SV=1 1 107 2.0E-24
sp|Q2KJH9|AL9A1_BOVIN 4-trimethylaminobutyraldehyde dehydrogenase OS=Bos taurus GN=ALDH9A1 PE=2 SV=1 1 106 2.0E-23
sp|Q9JLJ3|AL9A1_RAT 4-trimethylaminobutyraldehyde dehydrogenase OS=Rattus norvegicus GN=Aldh9a1 PE=1 SV=1 1 106 5.0E-23
sp|Q9JLJ2|AL9A1_MOUSE 4-trimethylaminobutyraldehyde dehydrogenase OS=Mus musculus GN=Aldh9a1 PE=1 SV=1 1 106 8.0E-23
sp|E1V7V8|DOEC_HALED Aspartate-semialdehyde dehydrogenase (Non-phosphorylating) OS=Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9) GN=doeC PE=3 SV=1 1 105 8.0E-23
sp|Q5R8A4|AL9A1_PONAB 4-trimethylaminobutyraldehyde dehydrogenase OS=Pongo abelii GN=ALDH9A1 PE=2 SV=2 1 106 2.0E-22
sp|P49189|AL9A1_HUMAN 4-trimethylaminobutyraldehyde dehydrogenase OS=Homo sapiens GN=ALDH9A1 PE=1 SV=3 1 106 2.0E-22
sp|P56533|BADH_GADMC Betaine aldehyde dehydrogenase OS=Gadus morhua subsp. callarias GN=aldh9A1 PE=1 SV=1 1 99 9.0E-22
sp|Q19A30|AL9A1_ORYLA Aldehyde dehydrogenase family 9 member A1 OS=Oryzias latipes GN=aldh9A1 PE=2 SV=1 1 99 1.0E-21
sp|Q9URW9|YLX7_SCHPO Putative aldehyde dehydrogenase-like protein C922.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC922.07c PE=3 SV=1 1 99 1.0E-21
sp|P28237|BADH_BETVU Betaine aldehyde dehydrogenase, chloroplastic OS=Beta vulgaris PE=2 SV=1 1 107 2.0E-21
sp|P17202|BADH_SPIOL Betaine aldehyde dehydrogenase, chloroplastic OS=Spinacia oleracea PE=1 SV=1 1 107 2.0E-21
sp|O32507|GABD_DEIRA Succinate-semialdehyde dehydrogenase [NADP(+)] OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=ssdA PE=3 SV=1 6 99 3.0E-21
sp|P94428|GABD_BACSU Succinate-semialdehyde dehydrogenase [NADP(+)] OS=Bacillus subtilis (strain 168) GN=gabD PE=1 SV=1 1 102 4.0E-21
sp|Q2KB42|BETB_RHIEC NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=betB PE=3 SV=1 1 102 4.0E-21
sp|Q66I21|AL8A1_DANRE Aldehyde dehydrogenase family 8 member A1 OS=Danio rerio GN=aldh8a1 PE=2 SV=1 2 100 4.0E-21
sp|A4WUY6|BETB_RHOS5 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=betB PE=3 SV=1 1 102 4.0E-21
sp|O34660|ALDH4_BACSU Putative aldehyde dehydrogenase DhaS OS=Bacillus subtilis (strain 168) GN=dhaS PE=3 SV=1 1 99 4.0E-21
sp|O24174|BADH1_ORYSJ Betaine aldehyde dehydrogenase 1 OS=Oryza sativa subsp. japonica GN=BADH1 PE=1 SV=1 1 107 5.0E-21
sp|B9JBA3|BETB_AGRRK NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=betB PE=3 SV=1 1 110 5.0E-21
sp|Q9STS1|BADH2_ARATH Betaine aldehyde dehydrogenase 2, mitochondrial OS=Arabidopsis thaliana GN=ALDH10A9 PE=2 SV=1 1 107 5.0E-21
sp|Q1MJU3|BETB_RHIL3 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=betB PE=3 SV=1 1 102 6.0E-21
sp|B3PTE1|BETB_RHIE6 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhizobium etli (strain CIAT 652) GN=betB PE=3 SV=1 1 110 7.0E-21
sp|B5ZUG3|BETB_RHILW NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=betB PE=3 SV=1 1 110 8.0E-21
sp|Q5R6B5|AL1B1_PONAB Aldehyde dehydrogenase X, mitochondrial OS=Pongo abelii GN=ALDH1B1 PE=2 SV=1 1 100 1.0E-20
sp|C3MIE5|BETB_RHISN NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhizobium sp. (strain NGR234) GN=betB PE=3 SV=1 1 106 1.0E-20
sp|B9KNS6|BETB_RHOSK NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=betB PE=3 SV=1 1 102 1.0E-20
sp|A6U6Y9|BETB_SINMW NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Sinorhizobium medicae (strain WSM419) GN=betB PE=3 SV=1 1 102 1.0E-20
sp|Q92YD2|BETB2_RHIME NAD/NADP-dependent betaine aldehyde dehydrogenase 2 OS=Rhizobium meliloti (strain 1021) GN=betB2 PE=3 SV=2 1 99 2.0E-20
sp|Q3J4E9|BETB_RHOS4 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=betB PE=3 SV=1 1 102 2.0E-20
sp|A3PI00|BETB_RHOS1 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=betB PE=3 SV=1 1 102 2.0E-20
sp|Q8UH56|BETB_AGRFC NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=betB PE=1 SV=1 1 99 3.0E-20
sp|Q8BH00|AL8A1_MOUSE Aldehyde dehydrogenase family 8 member A1 OS=Mus musculus GN=Aldh8a1 PE=1 SV=1 6 100 3.0E-20
sp|P71016|BETB_BACSU Betaine aldehyde dehydrogenase OS=Bacillus subtilis (strain 168) GN=gbsA PE=1 SV=1 1 99 4.0E-20
sp|P54222|BETB1_RHIME NAD/NADP-dependent betaine aldehyde dehydrogenase 1 OS=Rhizobium meliloti (strain 1021) GN=betB1 PE=3 SV=2 1 102 4.0E-20
sp|Q802W2|A9A1B_DANRE Aldehyde dehydrogenase family 9 member A1-B OS=Danio rerio GN=aldh9a1b PE=2 SV=2 1 99 4.0E-20
sp|P30837|AL1B1_HUMAN Aldehyde dehydrogenase X, mitochondrial OS=Homo sapiens GN=ALDH1B1 PE=1 SV=3 1 100 4.0E-20
sp|Q0P5F9|AL8A1_BOVIN Aldehyde dehydrogenase family 8 member A1 OS=Bos taurus GN=ALDH8A1 PE=2 SV=1 6 100 5.0E-20
sp|Q7ZVB2|A9A1A_DANRE Aldehyde dehydrogenase family 9 member A1-A OS=Danio rerio GN=aldh9a1a PE=2 SV=1 1 99 5.0E-20
sp|Q9H2A2|AL8A1_HUMAN Aldehyde dehydrogenase family 8 member A1 OS=Homo sapiens GN=ALDH8A1 PE=1 SV=1 6 100 6.0E-20
sp|Q40024|BADH_HORVU Betaine aldehyde dehydrogenase OS=Hordeum vulgare PE=2 SV=1 1 100 1.0E-19
sp|Q62148|AL1A2_MOUSE Retinal dehydrogenase 2 OS=Mus musculus GN=Aldh1a2 PE=1 SV=2 1 100 2.0E-19
sp|Q63639|AL1A2_RAT Retinal dehydrogenase 2 OS=Rattus norvegicus GN=Aldh1a2 PE=1 SV=2 1 100 2.0E-19
sp|O94788|AL1A2_HUMAN Retinal dehydrogenase 2 OS=Homo sapiens GN=ALDH1A2 PE=1 SV=3 1 100 2.0E-19
sp|O04895|BADH_AMAHP Betaine aldehyde dehydrogenase, chloroplastic OS=Amaranthus hypochondriacus GN=BADH4 PE=3 SV=1 1 100 2.0E-19
sp|Q66HF8|AL1B1_RAT Aldehyde dehydrogenase X, mitochondrial OS=Rattus norvegicus GN=Aldh1b1 PE=1 SV=1 1 100 2.0E-19
sp|P81178|ALDH2_MESAU Aldehyde dehydrogenase, mitochondrial OS=Mesocricetus auratus GN=ALDH2 PE=1 SV=1 1 100 3.0E-19
sp|P11884|ALDH2_RAT Aldehyde dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Aldh2 PE=1 SV=1 1 100 3.0E-19
sp|Q29491|ALDH2_MACPR Aldehyde dehydrogenase, cytosolic 2 (Fragment) OS=Macroscelides proboscideus PE=2 SV=1 1 100 3.0E-19
sp|P12762|ALDH2_HORSE Aldehyde dehydrogenase, mitochondrial OS=Equus caballus GN=ALDH2 PE=1 SV=1 1 100 3.0E-19
sp|P05091|ALDH2_HUMAN Aldehyde dehydrogenase, mitochondrial OS=Homo sapiens GN=ALDH2 PE=1 SV=2 1 100 3.0E-19
sp|Q5RF00|ALDH2_PONAB Aldehyde dehydrogenase, mitochondrial OS=Pongo abelii GN=ALDH2 PE=2 SV=1 1 100 3.0E-19
sp|Q2XQV4|ALDH2_PIG Aldehyde dehydrogenase, mitochondrial OS=Sus scrofa GN=ALDH2 PE=2 SV=1 1 100 3.0E-19
sp|P47895|AL1A3_HUMAN Aldehyde dehydrogenase family 1 member A3 OS=Homo sapiens GN=ALDH1A3 PE=1 SV=2 1 100 4.0E-19
sp|Q9CZS1|AL1B1_MOUSE Aldehyde dehydrogenase X, mitochondrial OS=Mus musculus GN=Aldh1b1 PE=1 SV=1 1 100 4.0E-19
sp|P47738|ALDH2_MOUSE Aldehyde dehydrogenase, mitochondrial OS=Mus musculus GN=Aldh2 PE=1 SV=1 1 100 4.0E-19
sp|Q8K4D8|AL1A3_RAT Aldehyde dehydrogenase family 1 member A3 OS=Rattus norvegicus GN=Aldh1a3 PE=2 SV=1 1 100 5.0E-19
sp|P20000|ALDH2_BOVIN Aldehyde dehydrogenase, mitochondrial OS=Bos taurus GN=ALDH2 PE=1 SV=2 1 100 5.0E-19
sp|Q84LK3|BADH2_ORYSJ Betaine aldehyde dehydrogenase 2 OS=Oryza sativa subsp. japonica GN=BADH2 PE=1 SV=1 1 108 6.0E-19
sp|B3VMC0|BADH2_ORYSI Betaine aldehyde dehydrogenase 2 OS=Oryza sativa subsp. indica GN=BADH2 PE=2 SV=1 1 108 6.0E-19
sp|P23105|XYLG_PSEPU 2-hydroxymuconic semialdehyde dehydrogenase OS=Pseudomonas putida GN=xylG PE=1 SV=1 2 99 6.0E-19
sp|Q3K5H4|BETB_PSEPF NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) GN=betB PE=3 SV=1 1 99 9.0E-19
sp|Q9JHW9|AL1A3_MOUSE Aldehyde dehydrogenase family 1 member A3 OS=Mus musculus GN=Aldh1a3 PE=1 SV=1 1 100 1.0E-18
sp|O93344|AL1A2_CHICK Retinal dehydrogenase 2 OS=Gallus gallus GN=ALDH1A2 PE=2 SV=2 1 100 1.0E-18
sp|Q985M6|BETB_RHILO NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=betB PE=3 SV=1 1 99 1.0E-18
sp|H8ZPX2|SAPD_PSESP 3-succinoylsemialdehyde-pyridine dehydrogenase OS=Pseudomonas sp. GN=ald PE=1 SV=1 1 99 2.0E-18
sp|Q9S795|BADH1_ARATH Betaine aldehyde dehydrogenase 1, chloroplastic OS=Arabidopsis thaliana GN=ALDH10A8 PE=2 SV=1 1 107 2.0E-18
sp|Q48CM6|BETB_PSE14 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=betB PE=3 SV=1 1 99 2.0E-18
sp|Q8CN24|ALDA_STAES Putative aldehyde dehydrogenase AldA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=aldA PE=3 SV=1 3 99 2.0E-18
sp|Q5HLA3|ALDA_STAEQ Putative aldehyde dehydrogenase AldA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=aldA PE=3 SV=1 3 99 2.0E-18
sp|Q4ZM62|BETB_PSEU2 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=betB PE=3 SV=1 1 99 2.0E-18
sp|Q88AE9|BETB_PSESM NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=betB PE=3 SV=1 1 99 2.0E-18
sp|Q29490|ALDH1_MACPR Aldehyde dehydrogenase, cytosolic 1 OS=Macroscelides proboscideus GN=ALDH1 PE=2 SV=1 1 100 2.0E-18
sp|Q28399|ALDH1_ELEED Aldehyde dehydrogenase, cytosolic 1 OS=Elephantulus edwardii GN=ALDH1 PE=1 SV=1 1 100 2.0E-18
sp|O74187|ALDH_AGABI Aldehyde dehydrogenase OS=Agaricus bisporus GN=aldA PE=3 SV=1 1 99 2.0E-18
sp|Q4K4K8|BETB_PSEF5 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=betB PE=3 SV=1 1 99 2.0E-18
sp|P27463|AL1A1_CHICK Retinal dehydrogenase 1 OS=Gallus gallus GN=ALDH1A1 PE=2 SV=1 1 100 3.0E-18
sp|Q9KWS5|AMNC_PSESP 2-aminomuconic 6-semialdehyde dehydrogenase OS=Pseudomonas sp. GN=amnC PE=1 SV=1 3 99 5.0E-18
sp|Q32FQ5|ABDH_SHIDS Gamma-aminobutyraldehyde dehydrogenase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=prr PE=3 SV=1 2 99 5.0E-18
sp|C3K3D2|BETB_PSEFS NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas fluorescens (strain SBW25) GN=betB PE=3 SV=1 1 99 5.0E-18
sp|A8GHZ8|ABDH_SERP5 Gamma-aminobutyraldehyde dehydrogenase OS=Serratia proteamaculans (strain 568) GN=prr PE=3 SV=1 3 99 6.0E-18
sp|P42269|HPCC_ECOLX 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase OS=Escherichia coli GN=hpcC PE=3 SV=1 1 88 6.0E-18
sp|Q8MI17|AL1A1_RABIT Retinal dehydrogenase 1 OS=Oryctolagus cuniculus GN=ALDH1A1 PE=2 SV=1 1 100 6.0E-18
sp|P19059|DMPC_PSEUF 2-hydroxymuconic semialdehyde dehydrogenase OS=Pseudomonas sp. (strain CF600) GN=dmpC PE=3 SV=1 2 99 6.0E-18
sp|Q8S528|AL2B7_ARATH Aldehyde dehydrogenase family 2 member B7, mitochondrial OS=Arabidopsis thaliana GN=ALDH2B7 PE=2 SV=2 1 99 7.0E-18
sp|C6DD82|ABDH_PECCP Gamma-aminobutyraldehyde dehydrogenase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=prr PE=3 SV=1 3 99 7.0E-18
sp|A4XPI6|BETB_PSEMY NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas mendocina (strain ymp) GN=betB PE=3 SV=1 1 99 7.0E-18
sp|P51647|AL1A1_RAT Retinal dehydrogenase 1 OS=Rattus norvegicus GN=Aldh1a1 PE=1 SV=3 1 99 1.0E-17
sp|Q0T431|ABDH_SHIF8 Gamma-aminobutyraldehyde dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) GN=prr PE=3 SV=1 2 99 1.0E-17
sp|B6IAI9|ABDH_ECOSE Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli (strain SE11) GN=prr PE=3 SV=1 2 99 1.0E-17
sp|B7LZ33|ABDH_ECO8A Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O8 (strain IAI1) GN=prr PE=3 SV=1 2 99 1.0E-17
sp|A7ZLN7|ABDH_ECO24 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=prr PE=3 SV=1 2 99 1.0E-17
sp|B7L6F9|ABDH_ECO55 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=prr PE=3 SV=1 2 99 1.0E-17
sp|Q83R90|ABDH_SHIFL Gamma-aminobutyraldehyde dehydrogenase OS=Shigella flexneri GN=prr PE=3 SV=1 2 99 1.0E-17
sp|P77674|ABDH_ECOLI Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli (strain K12) GN=prr PE=1 SV=1 2 99 1.0E-17
sp|B1XDF5|ABDH_ECODH Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=prr PE=3 SV=1 2 99 1.0E-17
sp|C4ZVI3|ABDH_ECOBW Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=prr PE=3 SV=1 2 99 1.0E-17
sp|Q3Z1H6|ABDH_SHISS Gamma-aminobutyraldehyde dehydrogenase OS=Shigella sonnei (strain Ss046) GN=prr PE=3 SV=1 2 99 1.0E-17
sp|P23883|PUUC_ECOLI Aldehyde dehydrogenase PuuC OS=Escherichia coli (strain K12) GN=puuC PE=1 SV=2 2 99 2.0E-17
sp|Q9I8W8|AL1A2_TAEGU Retinal dehydrogenase 2 OS=Taeniopygia guttata GN=ALDH1A2 PE=2 SV=1 1 100 2.0E-17
sp|Q4L919|ALDA_STAHJ Putative aldehyde dehydrogenase AldA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=aldA PE=3 SV=1 3 99 2.0E-17
sp|Q87H52|BETB_VIBPA NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=betB PE=3 SV=1 1 99 2.0E-17
sp|Q7A4D8|ALD1_STAAN Putative aldehyde dehydrogenase SA1924 OS=Staphylococcus aureus (strain N315) GN=SA1924 PE=1 SV=1 1 99 2.0E-17
sp|Q99SD6|ALD1_STAAM Putative aldehyde dehydrogenase SAV2122 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2122 PE=1 SV=1 1 99 2.0E-17
sp|Q5HE78|ALD1_STAAC Putative aldehyde dehydrogenase SACOL2114 OS=Staphylococcus aureus (strain COL) GN=SACOL2114 PE=3 SV=1 1 99 2.0E-17
sp|Q2FWD6|ALD1_STAA8 Putative aldehyde dehydrogenase SAOUHSC_02363 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02363 PE=3 SV=1 1 99 2.0E-17
sp|Q2FF06|ALD1_STAA3 Putative aldehyde dehydrogenase SAUSA300_2076 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2076 PE=3 SV=1 1 99 2.0E-17
sp|Q8NVG4|ALD1_STAAW Putative aldehyde dehydrogenase MW2046 OS=Staphylococcus aureus (strain MW2) GN=MW2046 PE=3 SV=1 1 99 2.0E-17
sp|Q6G7I8|ALD1_STAAS Putative aldehyde dehydrogenase SAS2025 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2025 PE=3 SV=1 1 99 2.0E-17
sp|Q6GEV3|ALD1_STAAR Putative aldehyde dehydrogenase SAR2210 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2210 PE=3 SV=1 1 99 2.0E-17
sp|A7ZWV5|BETB_ECOHS NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=betB PE=3 SV=1 1 99 2.0E-17
sp|Q2YUN1|ALD1_STAAB Putative aldehyde dehydrogenase SAB2006c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB2006c PE=3 SV=1 1 99 2.0E-17
sp|P86886|AL1A1_MESAU Retinal dehydrogenase 1 OS=Mesocricetus auratus GN=ALDH1A1 PE=1 SV=1 1 99 2.0E-17
sp|Q9SU63|AL2B4_ARATH Aldehyde dehydrogenase family 2 member B4, mitochondrial OS=Arabidopsis thaliana GN=ALDH2B4 PE=2 SV=1 1 99 3.0E-17
sp|Q0T7M9|BETB_SHIF8 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) GN=betB PE=3 SV=1 1 99 3.0E-17
sp|P08157|ALDH_EMENI Aldehyde dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aldA PE=3 SV=2 1 99 3.0E-17
sp|B7N8L4|BETB_ECOLU NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=betB PE=3 SV=1 1 99 3.0E-17
sp|B7L441|BETB_ECO55 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=betB PE=3 SV=1 1 99 3.0E-17
sp|B6I075|BETB_ECOSE NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli (strain SE11) GN=betB PE=3 SV=1 1 99 3.0E-17
sp|Q88CW7|BETB_PSEPK NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas putida (strain KT2440) GN=betB PE=3 SV=1 1 99 3.0E-17
sp|A5WA96|BETB_PSEP1 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=betB PE=3 SV=1 1 99 3.0E-17
sp|Q8GAK7|ALDH_ARTNI Aldehyde dehydrogenase OS=Arthrobacter nicotinovorans GN=aldh PE=1 SV=1 1 99 3.0E-17
sp|C0RHQ3|BETB_BRUMB NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=betB PE=3 SV=1 1 99 4.0E-17
sp|P48644|AL1A1_BOVIN Retinal dehydrogenase 1 OS=Bos taurus GN=ALDH1A1 PE=2 SV=3 1 100 4.0E-17
sp|P51977|AL1A1_SHEEP Retinal dehydrogenase 1 OS=Ovis aries GN=ALDH1A1 PE=1 SV=2 1 100 4.0E-17
sp|P13601|AL1A7_RAT Aldehyde dehydrogenase, cytosolic 1 OS=Rattus norvegicus GN=Aldh1a7 PE=1 SV=2 1 99 4.0E-17
sp|P24549|AL1A1_MOUSE Retinal dehydrogenase 1 OS=Mus musculus GN=Aldh1a1 PE=1 SV=5 1 99 4.0E-17
sp|B1J0W5|BETB_ECOLC NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=betB PE=3 SV=1 1 99 4.0E-17
sp|P15437|AL1A1_HORSE Retinal dehydrogenase 1 OS=Equus caballus GN=ALDH1A1 PE=1 SV=1 1 100 4.0E-17
sp|A5VPA5|BETB_BRUO2 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=betB PE=3 SV=1 1 99 5.0E-17
sp|Q8YFY0|BETB_BRUME NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=betB PE=3 SV=2 1 99 5.0E-17
sp|Q57EI0|BETB_BRUAB NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Brucella abortus biovar 1 (strain 9-941) GN=betB PE=3 SV=1 1 99 5.0E-17
sp|Q2YMP8|BETB_BRUA2 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Brucella abortus (strain 2308) GN=betB PE=3 SV=1 1 99 5.0E-17
sp|B2SA42|BETB_BRUA1 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Brucella abortus (strain S19) GN=betB PE=3 SV=1 1 99 5.0E-17
sp|Q8G1Z9|BETB_BRUSU NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Brucella suis biovar 1 (strain 1330) GN=betB PE=3 SV=1 1 99 5.0E-17
sp|A9M9H7|BETB_BRUC2 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=betB PE=3 SV=1 1 99 5.0E-17
sp|Q49Z69|ALD1_STAS1 Putative aldehyde dehydrogenase SSP0762 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0762 PE=3 SV=1 1 99 5.0E-17
sp|P52476|AL1B1_BOVIN Aldehyde dehydrogenase X, mitochondrial (Fragment) OS=Bos taurus GN=ALDH1B1 PE=2 SV=2 1 100 5.0E-17
sp|B0CKN3|BETB_BRUSI NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=betB PE=3 SV=1 1 99 5.0E-17
sp|B7M2V6|BETB_ECO8A NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O8 (strain IAI1) GN=betB PE=3 SV=1 1 99 6.0E-17
sp|A7ZI51|BETB_ECO24 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=betB PE=3 SV=1 1 99 6.0E-17
sp|B7NK50|BETB_ECO7I NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=betB PE=3 SV=1 1 99 6.0E-17
sp|A6X2G8|BETB_OCHA4 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=betB PE=3 SV=1 1 99 6.0E-17
sp|B7UJG5|BETB_ECO27 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=betB PE=3 SV=1 1 99 6.0E-17
sp|P17445|BETB_ECOLI NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli (strain K12) GN=betB PE=1 SV=3 1 99 7.0E-17
sp|B1XET7|BETB_ECODH NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=betB PE=3 SV=1 1 99 7.0E-17
sp|B5Z1R1|BETB_ECO5E NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=betB PE=3 SV=1 1 99 7.0E-17
sp|Q7AH91|BETB_ECO57 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O157:H7 GN=betB PE=3 SV=3 1 99 7.0E-17
sp|Q6D6Y7|ABDH_PECAS Gamma-aminobutyraldehyde dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=prr PE=3 SV=1 3 99 7.0E-17
sp|Q8FKI8|BETB_ECOL6 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=betB PE=3 SV=3 1 99 8.0E-17
sp|P9WNX9|GABD1_MYCTU Succinate-semialdehyde dehydrogenase [NADP(+)] 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gabD1 PE=1 SV=1 1 99 1.0E-16
sp|P9WNX8|GABD1_MYCTO Succinate-semialdehyde dehydrogenase [NADP(+)] 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=gabD1 PE=3 SV=1 1 99 1.0E-16
sp|A5TYV9|GABD1_MYCTA Succinate-semialdehyde dehydrogenase [NADP(+)] 1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=gabD1 PE=3 SV=2 1 99 1.0E-16
sp|A1KF54|GABD1_MYCBP Succinate-semialdehyde dehydrogenase [NADP(+)] 1 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=gabD1 PE=3 SV=2 1 99 1.0E-16
sp|Q7U2I0|GABD1_MYCBO Succinate-semialdehyde dehydrogenase [NADP(+)] 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=gabD1 PE=3 SV=2 1 99 1.0E-16
sp|A3M365|BETB_ACIBT NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=betB PE=3 SV=2 1 99 1.0E-16
sp|Q0TKW0|BETB_ECOL5 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=betB PE=3 SV=1 1 99 1.0E-16
sp|B2HV80|BETB_ACIBC NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Acinetobacter baumannii (strain ACICU) GN=betB PE=3 SV=1 1 99 1.0E-16
sp|B0V944|BETB_ACIBY NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Acinetobacter baumannii (strain AYE) GN=betB PE=3 SV=1 1 99 1.0E-16
sp|B7I896|BETB_ACIB5 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Acinetobacter baumannii (strain AB0057) GN=betB PE=3 SV=1 1 99 1.0E-16
sp|B7GYG4|BETB_ACIB3 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Acinetobacter baumannii (strain AB307-0294) GN=betB PE=3 SV=1 1 99 1.0E-16
sp|Q4L803|ALD1_STAHJ Putative aldehyde dehydrogenase SH0913 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0913 PE=3 SV=2 1 99 1.0E-16
sp|P00352|AL1A1_HUMAN Retinal dehydrogenase 1 OS=Homo sapiens GN=ALDH1A1 PE=1 SV=2 1 100 1.0E-16
sp|O35945|AL1A7_MOUSE Aldehyde dehydrogenase, cytosolic 1 OS=Mus musculus GN=Aldh1a7 PE=1 SV=1 1 99 1.0E-16
sp|Q1IG69|BETB_PSEE4 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas entomophila (strain L48) GN=betB PE=3 SV=1 1 99 1.0E-16
sp|Q3SY69|AL1L2_HUMAN Mitochondrial 10-formyltetrahydrofolate dehydrogenase OS=Homo sapiens GN=ALDH1L2 PE=1 SV=2 1 100 1.0E-16
sp|Q6D6E0|BETB_PECAS NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=betB PE=3 SV=1 1 99 2.0E-16
sp|B0KN18|BETB_PSEPG NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas putida (strain GB-1) GN=betB PE=3 SV=1 1 99 2.0E-16
sp|B1J2K9|BETB_PSEPW NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas putida (strain W619) GN=betB PE=3 SV=1 1 99 2.0E-16
sp|P30841|CROM_ENTDO Omega-crystallin OS=Enteroctopus dofleini PE=1 SV=3 1 99 2.0E-16
sp|B0VST2|BETB_ACIBS NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Acinetobacter baumannii (strain SDF) GN=betB PE=3 SV=1 1 99 2.0E-16
sp|Q8CNI5|ALD1_STAES Putative aldehyde dehydrogenase SE_1720 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1720 PE=3 SV=1 1 99 2.0E-16
sp|Q5HMA0|ALD1_STAEQ Putative aldehyde dehydrogenase SERP1729 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1729 PE=3 SV=1 1 99 2.0E-16
sp|Q63KK8|BETB_BURPS NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia pseudomallei (strain K96243) GN=betB PE=3 SV=1 1 99 2.0E-16
sp|Q9L4K1|BETB_CHRSD NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=betB PE=3 SV=1 1 99 2.0E-16
sp|P0C6D7|ALDH_VIBCH Aldehyde dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=aldA PE=3 SV=1 1 108 2.0E-16
sp|A5F3A7|ALDH_VIBC3 Aldehyde dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=aldA PE=3 SV=2 1 108 2.0E-16
sp|Q27640|ALDH_ENCBU Aldehyde dehydrogenase OS=Enchytraeus buchholzi GN=ALDH PE=2 SV=1 1 99 3.0E-16
sp|B7LR95|ABDH_ESCF3 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=prr PE=3 SV=1 2 99 3.0E-16
sp|B2FQ90|BETB_STRMK NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Stenotrophomonas maltophilia (strain K279a) GN=betB PE=3 SV=1 1 99 3.0E-16
sp|Q8HYE4|AL1A1_MACFA Retinal dehydrogenase 1 OS=Macaca fascicularis GN=ALDH1A1 PE=2 SV=3 1 100 4.0E-16
sp|B4SHW0|BETB_STRM5 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Stenotrophomonas maltophilia (strain R551-3) GN=betB PE=3 SV=1 1 99 4.0E-16
sp|B1LIJ8|BETB_ECOSM NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=betB PE=3 SV=1 1 99 4.0E-16
sp|B7URJ0|ABDH_ECO27 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=prr PE=3 SV=1 2 99 4.0E-16
sp|Q1RBX3|ABDH_ECOUT Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=prr PE=3 SV=1 2 99 4.0E-16
sp|Q8FHK7|ABDH_ECOL6 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=prr PE=3 SV=1 2 99 4.0E-16
sp|Q0THX6|ABDH_ECOL5 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=prr PE=3 SV=1 2 99 4.0E-16
sp|A1AB46|ABDH_ECOK1 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O1:K1 / APEC GN=prr PE=3 SV=1 2 99 4.0E-16
sp|B7MUN0|ABDH_ECO81 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O81 (strain ED1a) GN=prr PE=3 SV=1 2 99 4.0E-16
sp|B7MMS8|ABDH_ECO45 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=prr PE=3 SV=1 2 99 4.0E-16
sp|B5Z0W0|ABDH_ECO5E Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=prr PE=3 SV=1 2 99 4.0E-16
sp|Q8X9W5|ABDH_ECO57 Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O157:H7 GN=prr PE=3 SV=1 2 99 4.0E-16
sp|B1IS15|ABDH_ECOLC Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=prr PE=3 SV=1 2 99 4.0E-16
sp|A8A002|ABDH_ECOHS Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=prr PE=3 SV=1 2 99 4.0E-16
sp|B1LFH3|ABDH_ECOSM Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=prr PE=3 SV=1 2 99 5.0E-16
sp|B7N4K1|ABDH_ECOLU Gamma-aminobutyraldehyde dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=prr PE=3 SV=1 2 99 5.0E-16
sp|P76149|SAD_ECOLI Succinate semialdehyde dehydrogenase [NAD(P)+] Sad OS=Escherichia coli (strain K12) GN=sad PE=1 SV=2 6 99 5.0E-16
sp|Q8K009|AL1L2_MOUSE Mitochondrial 10-formyltetrahydrofolate dehydrogenase OS=Mus musculus GN=Aldh1l2 PE=1 SV=2 1 100 5.0E-16
sp|A8GBX8|BETB_SERP5 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Serratia proteamaculans (strain 568) GN=betB PE=3 SV=1 1 99 5.0E-16
sp|H1ZV37|GEOB_CASDE Geranial dehydrogenase OS=Castellaniella defragrans GN=geoB PE=1 SV=1 3 99 6.0E-16
sp|Q9RYG9|ALDH_DEIRA Aldehyde dehydrogenase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=aldA PE=3 SV=1 1 99 6.0E-16
sp|A4VKC2|BETB_PSEU5 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas stutzeri (strain A1501) GN=betB PE=3 SV=1 1 99 8.0E-16
sp|C6DKY5|BETB_PECCP NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=betB PE=3 SV=1 1 99 9.0E-16
sp|B5Y007|BETB_KLEP3 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Klebsiella pneumoniae (strain 342) GN=betB PE=3 SV=1 1 99 9.0E-16
sp|B7MCD1|BETB_ECO45 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=betB PE=3 SV=1 1 99 9.0E-16
sp|A7N2Q0|BETB_VIBCB NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=betB PE=3 SV=1 1 99 1.0E-15
sp|Q6GCV9|ALDA_STAAS Putative aldehyde dehydrogenase AldA OS=Staphylococcus aureus (strain MSSA476) GN=aldA PE=3 SV=1 3 99 1.0E-15
sp|Q7A1Y7|ALDA_STAAW Putative aldehyde dehydrogenase AldA OS=Staphylococcus aureus (strain MW2) GN=aldA PE=3 SV=1 3 99 1.0E-15
sp|Q6GKD8|ALDA_STAAR Putative aldehyde dehydrogenase AldA OS=Staphylococcus aureus (strain MRSA252) GN=aldA PE=3 SV=1 3 99 1.0E-15
sp|Q7A825|ALDA_STAAN Putative aldehyde dehydrogenase AldA OS=Staphylococcus aureus (strain N315) GN=aldA PE=1 SV=1 3 99 1.0E-15
sp|Q99X54|ALDA_STAAM Putative aldehyde dehydrogenase AldA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=aldA PE=3 SV=1 3 99 1.0E-15
sp|Q5HJK3|ALDA_STAAC Putative aldehyde dehydrogenase AldA OS=Staphylococcus aureus (strain COL) GN=aldA PE=3 SV=1 3 99 1.0E-15
sp|Q2G1J0|ALDA_STAA8 Putative aldehyde dehydrogenase AldA OS=Staphylococcus aureus (strain NCTC 8325) GN=aldA PE=3 SV=1 3 99 1.0E-15
sp|Q2FK94|ALDA_STAA3 Putative aldehyde dehydrogenase AldA OS=Staphylococcus aureus (strain USA300) GN=aldA PE=3 SV=1 3 99 1.0E-15
sp|B1JSQ9|BETB_YERPY NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=betB PE=3 SV=1 1 99 1.0E-15
sp|B2K8U5|BETB_YERPB NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=betB PE=3 SV=1 1 99 1.0E-15
sp|A7FKL5|BETB_YERP3 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=betB PE=3 SV=1 1 99 1.0E-15
sp|A4TNP1|BETB_YERPP NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Yersinia pestis (strain Pestoides F) GN=betB PE=3 SV=1 1 99 1.0E-15
sp|Q1CFR8|BETB_YERPN NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=betB PE=3 SV=1 1 99 1.0E-15
sp|Q8ZGV9|BETB_YERPE NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Yersinia pestis GN=betB PE=3 SV=1 1 99 1.0E-15
sp|Q1C931|BETB_YERPA NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=betB PE=3 SV=1 1 99 1.0E-15
sp|O14293|YF19_SCHPO Putative aldehyde dehydrogenase-like protein C9E9.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9E9.09c PE=1 SV=1 1 108 1.0E-15
sp|Q66D53|BETB_YERPS NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=betB PE=3 SV=1 1 99 2.0E-15
sp|A9MQY3|ABDH_SALAR Gamma-aminobutyraldehyde dehydrogenase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=prr PE=3 SV=1 2 99 2.0E-15
sp|A6W2P7|BETB_MARMS NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Marinomonas sp. (strain MWYL1) GN=betB PE=3 SV=1 1 99 2.0E-15
sp|O75891|AL1L1_HUMAN Cytosolic 10-formyltetrahydrofolate dehydrogenase OS=Homo sapiens GN=ALDH1L1 PE=1 SV=2 1 100 2.0E-15
sp|Q63ZT8|AL1L1_XENTR Cytosolic 10-formyltetrahydrofolate dehydrogenase OS=Xenopus tropicalis GN=aldh1l1 PE=2 SV=1 1 100 2.0E-15
sp|Q5RFM9|AL1L1_PONAB Cytosolic 10-formyltetrahydrofolate dehydrogenase OS=Pongo abelii GN=ALDH1L1 PE=2 SV=1 1 100 2.0E-15
sp|Q2YV11|ALDA_STAAB Putative aldehyde dehydrogenase AldA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=aldA PE=3 SV=1 3 99 2.0E-15
sp|P40108|ALDH_DAVTA Aldehyde dehydrogenase OS=Davidiella tassiana GN=CLAH10 PE=1 SV=2 1 100 3.0E-15
sp|C0Q4N4|ABDH_SALPC Gamma-aminobutyraldehyde dehydrogenase OS=Salmonella paratyphi C (strain RKS4594) GN=prr PE=3 SV=1 2 99 3.0E-15
sp|Q8ZPC9|ABDH_SALTY Gamma-aminobutyraldehyde dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prr PE=3 SV=2 2 99 3.0E-15
sp|Q57P61|ABDH_SALCH Gamma-aminobutyraldehyde dehydrogenase OS=Salmonella choleraesuis (strain SC-B67) GN=prr PE=3 SV=2 2 99 3.0E-15
sp|Q8R0Y6|AL1L1_MOUSE Cytosolic 10-formyltetrahydrofolate dehydrogenase OS=Mus musculus GN=Aldh1l1 PE=1 SV=1 1 100 3.0E-15
sp|Q8Z747|ABDH_SALTI Gamma-aminobutyraldehyde dehydrogenase OS=Salmonella typhi GN=prr PE=3 SV=2 2 99 3.0E-15
sp|A9MYQ4|ABDH_SALPB Gamma-aminobutyraldehyde dehydrogenase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=prr PE=3 SV=1 2 99 3.0E-15
sp|A1UVS4|BETB_BURMS NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia mallei (strain SAVP1) GN=betB PE=3 SV=1 1 99 4.0E-15
sp|Q62CH7|BETB_BURMA NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia mallei (strain ATCC 23344) GN=betB PE=3 SV=1 1 99 4.0E-15
sp|A2RWD6|BETB_BURM9 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia mallei (strain NCTC 10229) GN=betB PE=3 SV=1 1 99 4.0E-15
sp|A3MEC6|BETB_BURM7 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia mallei (strain NCTC 10247) GN=betB PE=3 SV=1 1 99 4.0E-15
sp|A3NKP8|BETB_BURP6 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia pseudomallei (strain 668) GN=betB PE=3 SV=1 1 99 4.0E-15
sp|P28037|AL1L1_RAT Cytosolic 10-formyltetrahydrofolate dehydrogenase OS=Rattus norvegicus GN=Aldh1l1 PE=1 SV=3 1 100 4.0E-15
sp|Q3JLL8|BETB_BURP1 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia pseudomallei (strain 1710b) GN=betB PE=3 SV=1 1 99 4.0E-15
sp|A3P6B0|BETB_BURP0 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia pseudomallei (strain 1106a) GN=betB PE=3 SV=1 1 99 4.0E-15
sp|A4WAR9|ABDH_ENT38 Gamma-aminobutyraldehyde dehydrogenase OS=Enterobacter sp. (strain 638) GN=prr PE=3 SV=1 2 99 4.0E-15
sp|Q02DY9|BETB_PSEAB NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=betB PE=3 SV=1 1 99 4.0E-15
sp|A6VEI4|BETB_PSEA7 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas aeruginosa (strain PA7) GN=betB PE=3 SV=1 1 99 4.0E-15
sp|Q9HTJ1|BETB_PSEAE NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=betB PE=1 SV=1 1 99 4.0E-15
sp|B7V5R4|BETB_PSEA8 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Pseudomonas aeruginosa (strain LESB58) GN=betB PE=3 SV=1 1 99 4.0E-15
sp|Q6GNL7|AL1L1_XENLA Cytosolic 10-formyltetrahydrofolate dehydrogenase OS=Xenopus laevis GN=aldh1l1 PE=2 SV=1 1 100 5.0E-15
sp|Q58806|LADH_METJA Lactaldehyde dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1411 PE=1 SV=2 7 99 9.0E-15
sp|A8AGJ9|ABDH_CITK8 Gamma-aminobutyraldehyde dehydrogenase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=prr PE=3 SV=1 2 99 1.0E-14
sp|O05619|VDH_PSEUH Vanillin dehydrogenase OS=Pseudomonas sp. (strain HR199 / DSM 7063) GN=vdh PE=1 SV=1 1 100 1.0E-14
sp|B7VQ28|BETB_VIBTL NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Vibrio tasmaniensis (strain LGP32) GN=betB PE=3 SV=1 1 99 1.0E-14
sp|Q5PHV8|ABDH_SALPA Gamma-aminobutyraldehyde dehydrogenase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=prr PE=3 SV=2 2 99 1.0E-14
sp|B4EHJ1|BETB_BURCJ NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=betB PE=3 SV=1 1 99 2.0E-14
sp|Q39A43|BETB_BURL3 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=betB PE=3 SV=1 1 99 2.0E-14
sp|B1K708|BETB_BURCC NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia cenocepacia (strain MC0-3) GN=betB PE=3 SV=1 1 99 2.0E-14
sp|Q2BN77|SAFD_NEPCE Sulfoacetaldehyde dehydrogenase OS=Neptuniibacter caesariensis GN=safD PE=1 SV=1 3 99 2.0E-14
sp|Q1JUP4|KGSDH_AZOBR Alpha-ketoglutaric semialdehyde dehydrogenase OS=Azospirillum brasilense GN=araE PE=1 SV=1 7 101 2.0E-14
sp|A4JJG5|BETB_BURVG NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=betB PE=3 SV=1 1 99 2.0E-14
sp|B1Z033|BETB_BURA4 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia ambifaria (strain MC40-6) GN=betB PE=3 SV=1 1 99 2.0E-14
sp|A9AN00|BETB_BURM1 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=betB PE=3 SV=1 1 99 2.0E-14
sp|Q0B712|BETB_BURCM NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=betB PE=3 SV=1 1 99 2.0E-14
sp|A0B2F6|BETB_BURCH NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia cenocepacia (strain HI2424) GN=betB PE=3 SV=1 1 99 2.0E-14
sp|Q1BQE1|BETB_BURCA NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia cenocepacia (strain AU 1054) GN=betB PE=3 SV=1 1 99 2.0E-14
sp|P30842|CROM_NOTSL Omega-crystallin OS=Nototodarus sloanii PE=2 SV=3 1 99 3.0E-14
sp|O69497|GABD1_MYCLE Succinate-semialdehyde dehydrogenase [NADP(+)] OS=Mycobacterium leprae (strain TN) GN=gabD1 PE=3 SV=1 1 99 3.0E-14
sp|B2JS88|BETB_BURP8 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=betB PE=3 SV=1 1 99 3.0E-14
sp|Q8D3K3|BETB_VIBVU NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Vibrio vulnificus (strain CMCP6) GN=betB PE=3 SV=1 1 99 4.0E-14
sp|P94682|TSAD1_COMTE 4-(hydroxymethyl)benzenesulfonate dehydrogenase TsaD1 OS=Comamonas testosteroni GN=tsaD1 PE=1 SV=1 3 97 4.0E-14
sp|A6VH72|LADH_METM7 Lactaldehyde dehydrogenase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=MmarC7_0731 PE=3 SV=1 7 99 4.0E-14
sp|Q9AHG1|TSAD2_COMTE Putative 4-(hydroxymethyl)benzenesulfonate dehydrogenase TsaD2 OS=Comamonas testosteroni GN=tsaD2 PE=5 SV=1 3 97 4.0E-14
sp|Q7MF13|BETB_VIBVY NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Vibrio vulnificus (strain YJ016) GN=betB PE=3 SV=1 1 99 4.0E-14
sp|P0A390|NAHF_PSEU8 Salicylaldehyde dehydrogenase OS=Pseudomonas sp. (strain C18) GN=doxF PE=3 SV=1 1 100 4.0E-14
sp|P0A391|NAHF_PSEPU Salicylaldehyde dehydrogenase OS=Pseudomonas putida GN=nahF PE=3 SV=1 1 100 4.0E-14
sp|A0PN13|GABD1_MYCUA Succinate-semialdehyde dehydrogenase [NADP(+)] 1 OS=Mycobacterium ulcerans (strain Agy99) GN=gabD1 PE=3 SV=1 1 102 5.0E-14
sp|P54114|ALDH3_YEAST Aldehyde dehydrogenase [NAD(P)+] 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALD3 PE=1 SV=1 6 99 6.0E-14
sp|Q8PPG7|BETB_XANAC NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=betB PE=3 SV=1 1 99 6.0E-14
sp|B0RNV0|BETB_XANCB NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Xanthomonas campestris pv. campestris (strain B100) GN=betB PE=3 SV=1 1 99 6.0E-14
sp|Q4UYN4|BETB_XANC8 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=betB PE=3 SV=1 1 99 6.0E-14
sp|Q3BXK7|BETB_XANC5 NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=betB PE=3 SV=1 1 99 7.0E-14
sp|Q8P5D8|BETB_XANCP NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=betB PE=3 SV=1 1 99 7.0E-14
sp|P42041|ALDH_ALTAL Aldehyde dehydrogenase OS=Alternaria alternata GN=ALTA10 PE=1 SV=2 1 100 8.0E-14
sp|P47771|ALDH2_YEAST Aldehyde dehydrogenase [NAD(P)+] 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALD2 PE=1 SV=2 6 99 9.0E-14
sp|P41751|ALDH_ASPNG Aldehyde dehydrogenase OS=Aspergillus niger GN=aldA PE=3 SV=1 1 99 1.0E-13
sp|A4FW36|LADH_METM5 Lactaldehyde dehydrogenase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=MmarC5_0090 PE=3 SV=1 7 99 1.0E-13
sp|O06837|STYD_PSEFL Phenylacetaldehyde dehydrogenase OS=Pseudomonas fluorescens GN=styD PE=1 SV=1 5 99 1.0E-13
sp|O06478|ALDH5_BACSU Putative aldehyde dehydrogenase YfmT OS=Bacillus subtilis (strain 168) GN=yfmT PE=2 SV=1 1 101 2.0E-13
sp|Q6FDF8|BETB_ACIAD NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=betB PE=3 SV=1 1 99 2.0E-13
sp|B2TCJ9|BETB_BURPP NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=betB PE=3 SV=1 1 99 2.0E-13
sp|Q13NG6|BETB_BURXL NAD/NADP-dependent betaine aldehyde dehydrogenase OS=Burkholderia xenovorans (strain LB400) GN=betB PE=3 SV=1 1 99 4.0E-13
sp|P54115|ALDH6_YEAST Magnesium-activated aldehyde dehydrogenase, cytosolic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALD6 PE=1 SV=4 1 99 5.0E-13
sp|Q9ZA11|ALDH_RHORT Aldehyde dehydrogenase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=Rru_A0931 PE=3 SV=2 1 99 6.0E-13
sp|Q6LX65|LADH_METMP Lactaldehyde dehydrogenase OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP1487 PE=3 SV=1 7 99 6.0E-13
sp|P9WNY1|ALDH_MYCTU Probable aldehyde dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0458 PE=1 SV=1 1 99 9.0E-13
sp|P9WNY0|ALDH_MYCTO Probable aldehyde dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0474 PE=3 SV=1 1 99 9.0E-13
sp|P63938|ALDH_MYCBO Probable aldehyde dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0467 PE=3 SV=1 1 99 9.0E-13
sp|P37685|ALDB_ECOLI Aldehyde dehydrogenase B OS=Escherichia coli (strain K12) GN=aldB PE=1 SV=2 1 108 9.0E-13
sp|H2IFE7|AHGD_VIBSJ 3,6-anhydro-alpha-L-galactose dehydrogenase OS=Vibrio sp. (strain EJY3) GN=Vejahgd PE=1 SV=1 1 98 9.0E-13
sp|P32872|ALDHY_YEASX Aldehyde dehydrogenase 2, mitochondrial OS=Saccharomyces cerevisiae GN=ALD2 PE=3 SV=1 1 90 1.0E-12
sp|Q9RJZ6|ALDH_STRCO Probable aldehyde dehydrogenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO1174 PE=3 SV=1 1 101 1.0E-12
sp|O69763|VDH_PSEFL Vanillin dehydrogenase OS=Pseudomonas fluorescens GN=vdh PE=3 SV=1 1 100 1.0E-12
sp|Q73TP5|GABD1_MYCPA Succinate-semialdehyde dehydrogenase [NADP(+)] OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=gabD1 PE=3 SV=1 1 102 4.0E-12
sp|A0QMB9|GABD1_MYCA1 Succinate-semialdehyde dehydrogenase [NADP(+)] OS=Mycobacterium avium (strain 104) GN=gabD1 PE=3 SV=1 1 102 4.0E-12
sp|P46367|ALDH4_YEAST Potassium-activated aldehyde dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALD4 PE=1 SV=2 1 99 6.0E-12
sp|P46368|DHA2_CUPNH Acetaldehyde dehydrogenase 2 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=acoD PE=1 SV=1 1 99 8.0E-12
sp|Q55585|GABD_SYNY3 Probable succinate-semialdehyde dehydrogenase [NADP(+)] OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gabD PE=3 SV=1 6 99 8.0E-12
sp|Q9FDS1|ALD1_ACISP Long-chain-aldehyde dehydrogenase OS=Acinetobacter sp. GN=ald1 PE=1 SV=1 1 99 9.0E-12
sp|P40047|ALDH5_YEAST Aldehyde dehydrogenase 5, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALD5 PE=1 SV=4 1 99 9.0E-12
sp|A6ZR27|ALDH5_YEAS7 Aldehyde dehydrogenase 5, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=ALD5 PE=3 SV=1 1 99 9.0E-12
sp|Q79EM7|PHDK_NOCSK 2-formylbenzoate dehydrogenase OS=Nocardioides sp. (strain KP7) GN=phdK PE=1 SV=1 3 101 1.0E-11
sp|Q59931|GAPN_STRMU NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=gapN PE=1 SV=2 1 99 1.0E-11
sp|P38694|MSC7_YEAST Putative aldehyde dehydrogenase-like protein YHR039C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSC7 PE=1 SV=1 1 99 4.0E-11
sp|Q9P7K9|YOSF_SCHPO Putative aldehyde dehydrogenase-like protein C21C3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21C3.15c PE=3 SV=1 1 99 5.0E-11
sp|Q0WSF1|AL221_ARATH Aldehyde dehydrogenase 22A1 OS=Arabidopsis thaliana GN=ALDH22A1 PE=2 SV=2 1 99 7.0E-11
sp|A6UQD0|LADH_METVS Lactaldehyde dehydrogenase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=Mevan_0796 PE=3 SV=1 7 104 1.0E-10
sp|F8JX40|FLUDE_STREN Fluoroacetaldehyde dehydrogenase OS=Streptomyces cattleya (strain ATCC 35852 / DSM 46488 / JCM 4925 / NBRC 14057 / NRRL 8057) GN=SCAT_0945 PE=1 SV=1 1 99 1.0E-10
sp|P80668|FEAB_ECOLI Phenylacetaldehyde dehydrogenase OS=Escherichia coli (strain K12) GN=feaB PE=1 SV=2 1 84 2.0E-10
sp|Q25417|ALDH2_LEITA Aldehyde dehydrogenase, mitochondrial OS=Leishmania tarentolae GN=ALDH2 PE=1 SV=1 1 99 4.0E-10
sp|P46369|THCA_RHOER EPTC-inducible aldehyde dehydrogenase OS=Rhodococcus erythropolis GN=thcA PE=1 SV=2 6 99 5.0E-10
sp|Q56YU0|AL2C4_ARATH Aldehyde dehydrogenase family 2 member C4 OS=Arabidopsis thaliana GN=ALDH2C4 PE=1 SV=2 1 99 6.0E-10
sp|A0R4Q0|GABD2_MYCS2 Putative succinate-semialdehyde dehydrogenase [NADP(+)] OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=gabD2 PE=3 SV=1 1 99 6.0E-10
sp|A6UVT6|LADH_META3 Lactaldehyde dehydrogenase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=Maeo_1030 PE=3 SV=1 7 99 7.0E-10
sp|O59808|BADH_SCHPO Probable betaine aldehyde dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu8 PE=2 SV=1 6 100 9.0E-10
sp|Q9HK01|GADH_THEAC D-glyceraldehyde dehydrogenase (NADP(+)) OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0809 PE=1 SV=1 6 109 9.0E-10
sp|Q3C1A6|GAPN_STREI NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus equinus GN=gapN PE=1 SV=1 1 98 3.0E-09
sp|Q8LK61|GAPN_WHEAT NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Triticum aestivum GN=GAPN PE=1 SV=2 1 98 3.0E-09
sp|P9WNX7|GABD2_MYCTU Putative succinate-semialdehyde dehydrogenase [NADP(+)] 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gabD2 PE=1 SV=1 1 99 3.0E-09
sp|P9WNX6|GABD2_MYCTO Putative succinate-semialdehyde dehydrogenase [NADP(+)] 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=gabD2 PE=3 SV=1 1 99 3.0E-09
sp|A5U390|GABD2_MYCTA Putative succinate-semialdehyde dehydrogenase [NADP(+)] 2 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=gabD2 PE=3 SV=1 1 99 3.0E-09
sp|A1KJE8|GABD2_MYCBP Putative succinate-semialdehyde dehydrogenase [NADP(+)] 2 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=gabD2 PE=3 SV=1 1 99 3.0E-09
sp|Q7TZP3|GABD2_MYCBO Putative succinate-semialdehyde dehydrogenase [NADP(+)] 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=gabD2 PE=3 SV=1 1 99 3.0E-09
sp|Q53197|Y4UC_RHISN Putative aldehyde-dehydrogenase-like protein y4uC OS=Rhizobium sp. (strain NGR234) GN=NGR_a01370 PE=3 SV=1 6 99 6.0E-09
sp|Q6L285|GADH_PICTO D-glyceraldehyde dehydrogenase (NADP(+)) OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=PTO0332 PE=1 SV=1 6 99 6.0E-09
sp|Q43272|GAPN_MAIZE NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Zea mays GN=GPN1 PE=2 SV=1 1 98 6.0E-09
sp|P94358|ALDY_BACSU Uncharacterized aldehyde dehydrogenase AldY OS=Bacillus subtilis (strain 168) GN=aldY PE=1 SV=1 3 100 1.0E-08
sp|Q9SNX8|GAPN_APIGR NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Apium graveolens PE=1 SV=1 1 98 1.0E-08
sp|P93338|GAPN_NICPL NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Nicotiana plumbaginifolia GN=GAPN PE=2 SV=1 1 98 1.0E-08
sp|Q1WIQ6|GAPN_ARATH NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Arabidopsis thaliana GN=ALDH11A3 PE=1 SV=2 1 98 1.0E-08
sp|P42329|ALDH_GEOSE Aldehyde dehydrogenase, thermostable OS=Geobacillus stearothermophilus GN=aldHT PE=1 SV=1 1 99 2.0E-08
sp|P81406|GAPN_PEA NADP-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Pisum sativum GN=GAPN PE=1 SV=1 1 98 2.0E-08
sp|P12693|ALDH_PSEOL Aldehyde dehydrogenase OS=Pseudomonas oleovorans GN=alkH PE=2 SV=1 1 99 3.0E-08
sp|Q70E96|AL3F1_ARATH Aldehyde dehydrogenase family 3 member F1 OS=Arabidopsis thaliana GN=ALDH3F1 PE=2 SV=2 3 110 1.0E-07
sp|P46329|ALDH3_BACSU Probable aldehyde dehydrogenase AldX OS=Bacillus subtilis (strain 168) GN=aldX PE=3 SV=2 1 99 1.0E-07
sp|A0PST9|GABD2_MYCUA Putative succinate-semialdehyde dehydrogenase [NADP(+)] 2 OS=Mycobacterium ulcerans (strain Agy99) GN=gabD2 PE=3 SV=1 1 99 1.0E-07
sp|P25553|ALDA_ECOLI Lactaldehyde dehydrogenase OS=Escherichia coli (strain K12) GN=aldA PE=1 SV=2 1 99 2.0E-07
sp|Q64057|AL7A1_RAT Alpha-aminoadipic semialdehyde dehydrogenase OS=Rattus norvegicus GN=Aldh7a1 PE=1 SV=2 3 100 2.0E-07
sp|Q9DBF1|AL7A1_MOUSE Alpha-aminoadipic semialdehyde dehydrogenase OS=Mus musculus GN=Aldh7a1 PE=1 SV=4 3 100 2.0E-07
sp|O57693|GAPN_THETE NAD(P)-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Thermoproteus tenax GN=gapN PE=1 SV=1 1 106 3.0E-07
sp|Q97U30|GAPN_SULSO NAD(P)-dependent glyceraldehyde-3-phosphate dehydrogenase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=gapN-3 PE=1 SV=1 6 99 3.0E-07
sp|P48448|AL3B2_HUMAN Aldehyde dehydrogenase family 3 member B2 OS=Homo sapiens GN=ALDH3B2 PE=2 SV=3 3 98 3.0E-07
sp|Q9A777|CALB_CAUCR Probable coniferyl aldehyde dehydrogenase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=calB PE=3 SV=1 1 99 5.0E-07
sp|P49419|AL7A1_HUMAN Alpha-aminoadipic semialdehyde dehydrogenase OS=Homo sapiens GN=ALDH7A1 PE=1 SV=5 2 100 5.0E-07
sp|A1U5W8|ASTD_MARHV N-succinylglutamate 5-semialdehyde dehydrogenase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=astD PE=3 SV=1 6 93 5.0E-07
sp|P42236|ALDH1_BACSU Probable aldehyde dehydrogenase YcbD OS=Bacillus subtilis (strain 168) GN=ycbD PE=3 SV=1 1 99 8.0E-07
sp|Q8EMV4|IOLA2_OCEIH Methylmalonate semialdehyde dehydrogenase [acylating] 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=iolA2 PE=3 SV=1 1 101 1.0E-06
sp|A6QR56|A16A1_BOVIN Aldehyde dehydrogenase family 16 member A1 OS=Bos taurus GN=ALDH16A1 PE=2 SV=1 7 93 2.0E-06
sp|Q571I9|A16A1_MOUSE Aldehyde dehydrogenase family 16 member A1 OS=Mus musculus GN=Aldh16a1 PE=1 SV=2 3 93 3.0E-06
sp|Q5KYR4|IOLA2_GEOKA Methylmalonate semialdehyde dehydrogenase [acylating] 2 OS=Geobacillus kaustophilus (strain HTA426) GN=iolA2 PE=3 SV=2 1 82 3.0E-06
sp|Q3T1L0|A16A1_RAT Aldehyde dehydrogenase family 16 member A1 OS=Rattus norvegicus GN=Aldh16a1 PE=2 SV=1 3 93 3.0E-06
sp|A4IPB2|IOLA1_GEOTN Methylmalonate semialdehyde dehydrogenase [acylating] 1 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=iolA1 PE=3 SV=2 1 82 4.0E-06
sp|Q7N2G9|ASTD_PHOLL N-succinylglutamate 5-semialdehyde dehydrogenase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=astD PE=3 SV=1 3 93 4.0E-06
sp|Q5XI42|AL3B1_RAT Aldehyde dehydrogenase family 3 member B1 OS=Rattus norvegicus GN=Aldh3b1 PE=2 SV=1 3 97 9.0E-06
sp|B1JMD1|ASTD_YERPY N-succinylglutamate 5-semialdehyde dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=astD PE=3 SV=1 3 93 9.0E-06
sp|A9QZ61|ASTD_YERPG N-succinylglutamate 5-semialdehyde dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=astD PE=3 SV=1 3 93 9.0E-06
sp|Q9ZC68|ASTD_YERPE N-succinylglutamate 5-semialdehyde dehydrogenase OS=Yersinia pestis GN=astD PE=3 SV=1 3 93 9.0E-06
sp|Q1C8A9|ASTD_YERPA N-succinylglutamate 5-semialdehyde dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=astD PE=3 SV=1 3 93 9.0E-06
sp|Q66B19|ASTD_YERPS N-succinylglutamate 5-semialdehyde dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=astD PE=3 SV=1 3 93 1.0E-05
sp|B2K296|ASTD_YERPB N-succinylglutamate 5-semialdehyde dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=astD PE=3 SV=1 3 93 1.0E-05
sp|A4TJU5|ASTD_YERPP N-succinylglutamate 5-semialdehyde dehydrogenase OS=Yersinia pestis (strain Pestoides F) GN=astD PE=3 SV=1 3 93 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4953
MAVAAEETFGPVAALFPFTTEAEVVELANTSDVGLAGYFFSRDLRRVHRVAEALAVGMVGVNTGIISDAAAPFGG
VKESGFGREGSRYGIAEYQNVKTVTCGGMGEPLQS*
Coding >Hirsu2|4953
ATGGCCGTCGCCGCCGAGGAGACCTTCGGCCCCGTCGCCGCCCTCTTCCCCTTCACGACCGAGGCCGAGGTGGTC
GAGCTGGCCAACACGTCCGACGTCGGCCTGGCCGGCTACTTCTTCTCGCGCGACCTGCGCCGCGTCCACCGCGTG
GCCGAGGCCCTCGCCGTCGGCATGGTCGGCGTCAACACGGGCATCATCTCGGACGCGGCCGCGCCCTTTGGCGGC
GTCAAGGAGAGCGGCTTCGGCCGCGAGGGCTCCCGCTACGGCATCGCCGAGTACCAGAACGTCAAGACCGTTACC
TGCGGCGGCATGGGCGAGCCACTCCAGAGCTGA
Transcript >Hirsu2|4953
ATGGCCGTCGCCGCCGAGGAGACCTTCGGCCCCGTCGCCGCCCTCTTCCCCTTCACGACCGAGGCCGAGGTGGTC
GAGCTGGCCAACACGTCCGACGTCGGCCTGGCCGGCTACTTCTTCTCGCGCGACCTGCGCCGCGTCCACCGCGTG
GCCGAGGCCCTCGCCGTCGGCATGGTCGGCGTCAACACGGGCATCATCTCGGACGCGGCCGCGCCCTTTGGCGGC
GTCAAGGAGAGCGGCTTCGGCCGCGAGGGCTCCCGCTACGGCATCGCCGAGTACCAGAACGTCAAGACCGTTACC
TGCGGCGGCATGGGCGAGCCACTCCAGAGCTGA
Gene >Hirsu2|4953
ATGGCCGTCGCCGCCGAGGAGACCTTCGGCCCCGTCGCCGCCCTCTTCCCCTTCACGACCGAGGCCGAGGTGGTC
GAGCTGGCCAACACGTCCGACGTCGGCCTGGCCGGCTACTTCTTCTCGCGCGACCTGCGCCGCGTCCACCGCGTG
GCCGAGGCCCTCGCCGTCGGCATGGTCGGCGTCAACACGGGCATCATCTCGGACGCGGCCGCGCCCTTTGGCGGC
GTCAAGGAGAGCGGCTTCGGCCGCGAGGGCTCCCGCTACGGCATCGCCGAGTACCAGAACGTCAAGACCGTTACC
TGCGGCGGCATGGGCGAGCCACTCCAGAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail