Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4952
Gene name
LocationContig_249:25790..26993
Strand-
Gene length (bp)1203
Transcript length (bp)1203
Coding sequence length (bp)1203
Protein length (aa) 401

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 3.8E-10 127 378
PF12146 Hydrolase_4 Serine aminopeptidase, S33 1.3E-07 149 243
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 2.8E-06 149 279

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1481 0.0797 0.9234 0.0822 0.0988 0.0209 0.1955 0.3306 0.1115 0.0088

SignalP

SignalP signal predicted Location Score
Yes 1 - 24 0.999733

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup870
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4213
Ophiocordyceps australis map64 (Brazil) OphauB2|208
Ophiocordyceps camponoti-floridani Ophcf2|07011
Ophiocordyceps camponoti-rufipedis Ophun1|667
Ophiocordyceps kimflemingae Ophio5|6686
Ophiocordyceps subramaniannii Hirsu2|4952 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8371

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4952
MNTSAFVPLAILLNPFAVATSAAATEFAANGFSNGIIGRSAGGRSTCISGDITLSINTTGTRILYAAPQEQMGVT
EALVELLQANSTFGTDAAAGGPSVISGHYSIFCKLCLPSEPARARKVRTVQLLTHGATLDHTYWDIAPGYSYVDA
AAAAGYATLSYDQLGVGNSDHPDPIQVVQATSQVAVAHELAGLLRHASLGGFDFSTVVGVGHSAGSTLTQAITTQ
YPDDFDAVVLSGISTSPASVALTVAAFNFVNANTDPAPKLKNLPAGFLTQQTAVGIQFAFYRYPNFDEDAFRRQV
ANKQTNTMGVLLTLGGIIAPSTRFTGPVDVVNGENDLVFCAGHCLYPVDQNKAVLAALYPAASSGSRTFIAEGAG
HAIAAHKSGPESFRHIMQFLKANDL*
Coding >Hirsu2|4952
ATGAACACCTCGGCTTTCGTCCCCCTGGCAATCCTCCTCAATCCGTTCGCGGTCGCGACCTCAGCCGCAGCGACG
GAATTCGCCGCCAATGGCTTTTCCAACGGCATTATCGGCCGATCCGCTGGCGGCCGCTCAACTTGCATCTCGGGC
GATATCACGCTGTCTATCAACACGACCGGGACGAGAATCCTGTACGCGGCGCCGCAAGAGCAGATGGGCGTGACC
GAGGCCCTCGTCGAGCTGCTCCAGGCCAACTCGACCTTTGGCACCGACGCCGCAGCCGGGGGGCCAAGCGTCATC
TCCGGCCATTACAGCATCTTCTGCAAGCTCTGCCTGCCCAGCGAACCGGCACGTGCGAGGAAAGTGAGGACAGTG
CAGCTGCTGACACACGGTGCAACCCTCGACCATACCTACTGGGATATTGCGCCGGGCTATAGCTACGTCGACGCC
GCCGCGGCCGCCGGCTACGCGACGCTCTCCTACGACCAGTTGGGCGTAGGGAACTCGGACCACCCGGACCCTATT
CAGGTCGTACAGGCAACTTCTCAGGTCGCCGTGGCGCACGAGCTGGCCGGGCTGCTGCGTCACGCAAGCCTGGGC
GGCTTCGACTTCAGCACCGTGGTCGGCGTCGGCCACAGCGCGGGAAGCACGCTGACCCAGGCTATCACCACGCAG
TACCCGGACGACTTCGACGCCGTGGTCCTGTCCGGCATCAGCACCAGCCCAGCCTCTGTCGCGCTCACCGTCGCC
GCATTCAACTTCGTCAACGCGAACACGGACCCGGCCCCCAAGTTGAAGAACCTCCCCGCCGGCTTCCTGACGCAG
CAGACGGCCGTCGGCATACAGTTCGCTTTCTACCGGTACCCCAACTTTGACGAGGACGCCTTCAGGCGACAGGTC
GCCAACAAGCAGACGAACACGATGGGCGTCCTGCTCACGCTGGGCGGCATCATCGCACCGTCGACACGGTTTACG
GGGCCGGTCGACGTGGTGAACGGGGAGAACGATCTCGTTTTCTGCGCCGGTCACTGTCTCTATCCCGTCGATCAG
AACAAGGCTGTCCTAGCGGCCCTCTATCCGGCGGCCTCGAGTGGAAGTCGGACGTTTATTGCCGAGGGTGCGGGG
CATGCTATCGCGGCCCATAAGAGCGGACCCGAGAGCTTTAGACATATAATGCAGTTCTTAAAGGCAAACGACCTA
TAA
Transcript >Hirsu2|4952
ATGAACACCTCGGCTTTCGTCCCCCTGGCAATCCTCCTCAATCCGTTCGCGGTCGCGACCTCAGCCGCAGCGACG
GAATTCGCCGCCAATGGCTTTTCCAACGGCATTATCGGCCGATCCGCTGGCGGCCGCTCAACTTGCATCTCGGGC
GATATCACGCTGTCTATCAACACGACCGGGACGAGAATCCTGTACGCGGCGCCGCAAGAGCAGATGGGCGTGACC
GAGGCCCTCGTCGAGCTGCTCCAGGCCAACTCGACCTTTGGCACCGACGCCGCAGCCGGGGGGCCAAGCGTCATC
TCCGGCCATTACAGCATCTTCTGCAAGCTCTGCCTGCCCAGCGAACCGGCACGTGCGAGGAAAGTGAGGACAGTG
CAGCTGCTGACACACGGTGCAACCCTCGACCATACCTACTGGGATATTGCGCCGGGCTATAGCTACGTCGACGCC
GCCGCGGCCGCCGGCTACGCGACGCTCTCCTACGACCAGTTGGGCGTAGGGAACTCGGACCACCCGGACCCTATT
CAGGTCGTACAGGCAACTTCTCAGGTCGCCGTGGCGCACGAGCTGGCCGGGCTGCTGCGTCACGCAAGCCTGGGC
GGCTTCGACTTCAGCACCGTGGTCGGCGTCGGCCACAGCGCGGGAAGCACGCTGACCCAGGCTATCACCACGCAG
TACCCGGACGACTTCGACGCCGTGGTCCTGTCCGGCATCAGCACCAGCCCAGCCTCTGTCGCGCTCACCGTCGCC
GCATTCAACTTCGTCAACGCGAACACGGACCCGGCCCCCAAGTTGAAGAACCTCCCCGCCGGCTTCCTGACGCAG
CAGACGGCCGTCGGCATACAGTTCGCTTTCTACCGGTACCCCAACTTTGACGAGGACGCCTTCAGGCGACAGGTC
GCCAACAAGCAGACGAACACGATGGGCGTCCTGCTCACGCTGGGCGGCATCATCGCACCGTCGACACGGTTTACG
GGGCCGGTCGACGTGGTGAACGGGGAGAACGATCTCGTTTTCTGCGCCGGTCACTGTCTCTATCCCGTCGATCAG
AACAAGGCTGTCCTAGCGGCCCTCTATCCGGCGGCCTCGAGTGGAAGTCGGACGTTTATTGCCGAGGGTGCGGGG
CATGCTATCGCGGCCCATAAGAGCGGACCCGAGAGCTTTAGACATATAATGCAGTTCTTAAAGGCAAACGACCTA
TAA
Gene >Hirsu2|4952
ATGAACACCTCGGCTTTCGTCCCCCTGGCAATCCTCCTCAATCCGTTCGCGGTCGCGACCTCAGCCGCAGCGACG
GAATTCGCCGCCAATGGCTTTTCCAACGGCATTATCGGCCGATCCGCTGGCGGCCGCTCAACTTGCATCTCGGGC
GATATCACGCTGTCTATCAACACGACCGGGACGAGAATCCTGTACGCGGCGCCGCAAGAGCAGATGGGCGTGACC
GAGGCCCTCGTCGAGCTGCTCCAGGCCAACTCGACCTTTGGCACCGACGCCGCAGCCGGGGGGCCAAGCGTCATC
TCCGGCCATTACAGCATCTTCTGCAAGCTCTGCCTGCCCAGCGAACCGGCACGTGCGAGGAAAGTGAGGACAGTG
CAGCTGCTGACACACGGTGCAACCCTCGACCATACCTACTGGGATATTGCGCCGGGCTATAGCTACGTCGACGCC
GCCGCGGCCGCCGGCTACGCGACGCTCTCCTACGACCAGTTGGGCGTAGGGAACTCGGACCACCCGGACCCTATT
CAGGTCGTACAGGCAACTTCTCAGGTCGCCGTGGCGCACGAGCTGGCCGGGCTGCTGCGTCACGCAAGCCTGGGC
GGCTTCGACTTCAGCACCGTGGTCGGCGTCGGCCACAGCGCGGGAAGCACGCTGACCCAGGCTATCACCACGCAG
TACCCGGACGACTTCGACGCCGTGGTCCTGTCCGGCATCAGCACCAGCCCAGCCTCTGTCGCGCTCACCGTCGCC
GCATTCAACTTCGTCAACGCGAACACGGACCCGGCCCCCAAGTTGAAGAACCTCCCCGCCGGCTTCCTGACGCAG
CAGACGGCCGTCGGCATACAGTTCGCTTTCTACCGGTACCCCAACTTTGACGAGGACGCCTTCAGGCGACAGGTC
GCCAACAAGCAGACGAACACGATGGGCGTCCTGCTCACGCTGGGCGGCATCATCGCACCGTCGACACGGTTTACG
GGGCCGGTCGACGTGGTGAACGGGGAGAACGATCTCGTTTTCTGCGCCGGTCACTGTCTCTATCCCGTCGATCAG
AACAAGGCTGTCCTAGCGGCCCTCTATCCGGCGGCCTCGAGTGGAAGTCGGACGTTTATTGCCGAGGGTGCGGGG
CATGCTATCGCGGCCCATAAGAGCGGACCCGAGAGCTTTAGACATATAATGCAGTTCTTAAAGGCAAACGACCTA
TAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail