Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4952
Gene name
LocationContig_249:25790..26993
Strand-
Gene length (bp)1203
Transcript length (bp)1203
Coding sequence length (bp)1203
Protein length (aa) 401

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 3.8E-10 127 378
PF12146 Hydrolase_4 Serine aminopeptidase, S33 1.3E-07 149 243
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 2.8E-06 149 279

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4952
MNTSAFVPLAILLNPFAVATSAAATEFAANGFSNGIIGRSAGGRSTCISGDITLSINTTGTRILYAAPQEQMGVT
EALVELLQANSTFGTDAAAGGPSVISGHYSIFCKLCLPSEPARARKVRTVQLLTHGATLDHTYWDIAPGYSYVDA
AAAAGYATLSYDQLGVGNSDHPDPIQVVQATSQVAVAHELAGLLRHASLGGFDFSTVVGVGHSAGSTLTQAITTQ
YPDDFDAVVLSGISTSPASVALTVAAFNFVNANTDPAPKLKNLPAGFLTQQTAVGIQFAFYRYPNFDEDAFRRQV
ANKQTNTMGVLLTLGGIIAPSTRFTGPVDVVNGENDLVFCAGHCLYPVDQNKAVLAALYPAASSGSRTFIAEGAG
HAIAAHKSGPESFRHIMQFLKANDL*
Coding >Hirsu2|4952
ATGAACACCTCGGCTTTCGTCCCCCTGGCAATCCTCCTCAATCCGTTCGCGGTCGCGACCTCAGCCGCAGCGACG
GAATTCGCCGCCAATGGCTTTTCCAACGGCATTATCGGCCGATCCGCTGGCGGCCGCTCAACTTGCATCTCGGGC
GATATCACGCTGTCTATCAACACGACCGGGACGAGAATCCTGTACGCGGCGCCGCAAGAGCAGATGGGCGTGACC
GAGGCCCTCGTCGAGCTGCTCCAGGCCAACTCGACCTTTGGCACCGACGCCGCAGCCGGGGGGCCAAGCGTCATC
TCCGGCCATTACAGCATCTTCTGCAAGCTCTGCCTGCCCAGCGAACCGGCACGTGCGAGGAAAGTGAGGACAGTG
CAGCTGCTGACACACGGTGCAACCCTCGACCATACCTACTGGGATATTGCGCCGGGCTATAGCTACGTCGACGCC
GCCGCGGCCGCCGGCTACGCGACGCTCTCCTACGACCAGTTGGGCGTAGGGAACTCGGACCACCCGGACCCTATT
CAGGTCGTACAGGCAACTTCTCAGGTCGCCGTGGCGCACGAGCTGGCCGGGCTGCTGCGTCACGCAAGCCTGGGC
GGCTTCGACTTCAGCACCGTGGTCGGCGTCGGCCACAGCGCGGGAAGCACGCTGACCCAGGCTATCACCACGCAG
TACCCGGACGACTTCGACGCCGTGGTCCTGTCCGGCATCAGCACCAGCCCAGCCTCTGTCGCGCTCACCGTCGCC
GCATTCAACTTCGTCAACGCGAACACGGACCCGGCCCCCAAGTTGAAGAACCTCCCCGCCGGCTTCCTGACGCAG
CAGACGGCCGTCGGCATACAGTTCGCTTTCTACCGGTACCCCAACTTTGACGAGGACGCCTTCAGGCGACAGGTC
GCCAACAAGCAGACGAACACGATGGGCGTCCTGCTCACGCTGGGCGGCATCATCGCACCGTCGACACGGTTTACG
GGGCCGGTCGACGTGGTGAACGGGGAGAACGATCTCGTTTTCTGCGCCGGTCACTGTCTCTATCCCGTCGATCAG
AACAAGGCTGTCCTAGCGGCCCTCTATCCGGCGGCCTCGAGTGGAAGTCGGACGTTTATTGCCGAGGGTGCGGGG
CATGCTATCGCGGCCCATAAGAGCGGACCCGAGAGCTTTAGACATATAATGCAGTTCTTAAAGGCAAACGACCTA
TAA
Transcript >Hirsu2|4952
ATGAACACCTCGGCTTTCGTCCCCCTGGCAATCCTCCTCAATCCGTTCGCGGTCGCGACCTCAGCCGCAGCGACG
GAATTCGCCGCCAATGGCTTTTCCAACGGCATTATCGGCCGATCCGCTGGCGGCCGCTCAACTTGCATCTCGGGC
GATATCACGCTGTCTATCAACACGACCGGGACGAGAATCCTGTACGCGGCGCCGCAAGAGCAGATGGGCGTGACC
GAGGCCCTCGTCGAGCTGCTCCAGGCCAACTCGACCTTTGGCACCGACGCCGCAGCCGGGGGGCCAAGCGTCATC
TCCGGCCATTACAGCATCTTCTGCAAGCTCTGCCTGCCCAGCGAACCGGCACGTGCGAGGAAAGTGAGGACAGTG
CAGCTGCTGACACACGGTGCAACCCTCGACCATACCTACTGGGATATTGCGCCGGGCTATAGCTACGTCGACGCC
GCCGCGGCCGCCGGCTACGCGACGCTCTCCTACGACCAGTTGGGCGTAGGGAACTCGGACCACCCGGACCCTATT
CAGGTCGTACAGGCAACTTCTCAGGTCGCCGTGGCGCACGAGCTGGCCGGGCTGCTGCGTCACGCAAGCCTGGGC
GGCTTCGACTTCAGCACCGTGGTCGGCGTCGGCCACAGCGCGGGAAGCACGCTGACCCAGGCTATCACCACGCAG
TACCCGGACGACTTCGACGCCGTGGTCCTGTCCGGCATCAGCACCAGCCCAGCCTCTGTCGCGCTCACCGTCGCC
GCATTCAACTTCGTCAACGCGAACACGGACCCGGCCCCCAAGTTGAAGAACCTCCCCGCCGGCTTCCTGACGCAG
CAGACGGCCGTCGGCATACAGTTCGCTTTCTACCGGTACCCCAACTTTGACGAGGACGCCTTCAGGCGACAGGTC
GCCAACAAGCAGACGAACACGATGGGCGTCCTGCTCACGCTGGGCGGCATCATCGCACCGTCGACACGGTTTACG
GGGCCGGTCGACGTGGTGAACGGGGAGAACGATCTCGTTTTCTGCGCCGGTCACTGTCTCTATCCCGTCGATCAG
AACAAGGCTGTCCTAGCGGCCCTCTATCCGGCGGCCTCGAGTGGAAGTCGGACGTTTATTGCCGAGGGTGCGGGG
CATGCTATCGCGGCCCATAAGAGCGGACCCGAGAGCTTTAGACATATAATGCAGTTCTTAAAGGCAAACGACCTA
TAA
Gene >Hirsu2|4952
ATGAACACCTCGGCTTTCGTCCCCCTGGCAATCCTCCTCAATCCGTTCGCGGTCGCGACCTCAGCCGCAGCGACG
GAATTCGCCGCCAATGGCTTTTCCAACGGCATTATCGGCCGATCCGCTGGCGGCCGCTCAACTTGCATCTCGGGC
GATATCACGCTGTCTATCAACACGACCGGGACGAGAATCCTGTACGCGGCGCCGCAAGAGCAGATGGGCGTGACC
GAGGCCCTCGTCGAGCTGCTCCAGGCCAACTCGACCTTTGGCACCGACGCCGCAGCCGGGGGGCCAAGCGTCATC
TCCGGCCATTACAGCATCTTCTGCAAGCTCTGCCTGCCCAGCGAACCGGCACGTGCGAGGAAAGTGAGGACAGTG
CAGCTGCTGACACACGGTGCAACCCTCGACCATACCTACTGGGATATTGCGCCGGGCTATAGCTACGTCGACGCC
GCCGCGGCCGCCGGCTACGCGACGCTCTCCTACGACCAGTTGGGCGTAGGGAACTCGGACCACCCGGACCCTATT
CAGGTCGTACAGGCAACTTCTCAGGTCGCCGTGGCGCACGAGCTGGCCGGGCTGCTGCGTCACGCAAGCCTGGGC
GGCTTCGACTTCAGCACCGTGGTCGGCGTCGGCCACAGCGCGGGAAGCACGCTGACCCAGGCTATCACCACGCAG
TACCCGGACGACTTCGACGCCGTGGTCCTGTCCGGCATCAGCACCAGCCCAGCCTCTGTCGCGCTCACCGTCGCC
GCATTCAACTTCGTCAACGCGAACACGGACCCGGCCCCCAAGTTGAAGAACCTCCCCGCCGGCTTCCTGACGCAG
CAGACGGCCGTCGGCATACAGTTCGCTTTCTACCGGTACCCCAACTTTGACGAGGACGCCTTCAGGCGACAGGTC
GCCAACAAGCAGACGAACACGATGGGCGTCCTGCTCACGCTGGGCGGCATCATCGCACCGTCGACACGGTTTACG
GGGCCGGTCGACGTGGTGAACGGGGAGAACGATCTCGTTTTCTGCGCCGGTCACTGTCTCTATCCCGTCGATCAG
AACAAGGCTGTCCTAGCGGCCCTCTATCCGGCGGCCTCGAGTGGAAGTCGGACGTTTATTGCCGAGGGTGCGGGG
CATGCTATCGCGGCCCATAAGAGCGGACCCGAGAGCTTTAGACATATAATGCAGTTCTTAAAGGCAAACGACCTA
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail