Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4937
Gene name
LocationContig_2484:307..1186
Strand+
Gene length (bp)879
Transcript length (bp)879
Coding sequence length (bp)879
Protein length (aa) 293

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17242 DUF5315 Disordered region of unknown function (DUF5315) 5.4E-26 104 171

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5658 0.4598 0.0704 0.1589 0.1729 0.0127 0.1081 0.2374 0.2889 0.5049

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5317
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|395
Ophiocordyceps australis map64 (Brazil) OphauB2|8154
Ophiocordyceps camponoti-rufipedis Ophun1|592
Ophiocordyceps kimflemingae Ophio5|1865
Ophiocordyceps subramaniannii Hirsu2|4937 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4937
MASTNRQPDASREMTWDVSENTTALQSKFRGKLREPPPTLFLHPSSGASHVSLPGIMAPGASVLGASSLRGEAST
SVERTVPVSLLSRAKSQLRRPASAINCTESNCGADRTDALWAEMQATLEEVELSASGGTHVFGPGHGLKLAQLRS
SQIALAQAWARSEADDAIETALRANDTTAPVDEVRNLKGAWVDAARSGSGEAADPSANARPESRGDAGADRFGSK
WEEETEMDILLARNRREANDQYFKRVNNGVIDVVSKLEYVAKAMRAVEQDSRDVWNETVNTSDHEIN*
Coding >Hirsu2|4937
ATGGCGTCGACCAATCGACAGCCCGATGCCTCTCGCGAGATGACATGGGATGTCAGTGAAAATACAACAGCTCTC
CAGTCGAAGTTCAGGGGCAAGCTGCGAGAGCCCCCGCCGACCCTGTTCTTGCATCCGTCTTCGGGTGCTTCTCAT
GTCTCTCTGCCAGGTATAATGGCCCCCGGGGCTTCAGTTCTAGGGGCTTCAAGCCTCAGGGGAGAAGCGTCCACC
AGTGTTGAGCGAACCGTACCTGTCTCGCTTCTGTCCCGGGCAAAATCTCAGCTCCGGCGCCCCGCCTCTGCGATC
AACTGTACAGAGTCCAACTGCGGTGCAGACAGGACAGATGCACTATGGGCTGAGATGCAGGCCACTCTGGAGGAG
GTTGAGCTGTCCGCCTCAGGAGGCACGCATGTTTTCGGCCCGGGACATGGTCTCAAACTTGCACAGCTACGCTCC
TCTCAAATTGCCCTCGCCCAAGCATGGGCAAGAAGCGAGGCAGACGACGCGATCGAGACAGCGCTTCGCGCCAAT
GACACGACAGCGCCGGTCGATGAGGTACGAAATTTAAAAGGAGCTTGGGTAGATGCAGCTCGAAGCGGTAGTGGA
GAAGCAGCAGACCCTTCAGCCAACGCGCGACCTGAGAGTCGTGGCGATGCTGGGGCAGATCGGTTCGGGTCAAAG
TGGGAGGAGGAAACAGAAATGGATATCCTTCTCGCCAGGAATCGGCGCGAGGCAAACGACCAATATTTTAAGCGA
GTCAATAATGGCGTCATAGACGTCGTTTCAAAGTTGGAATATGTAGCCAAAGCCATGCGGGCCGTTGAGCAAGAC
AGTAGGGATGTATGGAATGAAACCGTCAACACGAGCGATCACGAGATCAATTGA
Transcript >Hirsu2|4937
ATGGCGTCGACCAATCGACAGCCCGATGCCTCTCGCGAGATGACATGGGATGTCAGTGAAAATACAACAGCTCTC
CAGTCGAAGTTCAGGGGCAAGCTGCGAGAGCCCCCGCCGACCCTGTTCTTGCATCCGTCTTCGGGTGCTTCTCAT
GTCTCTCTGCCAGGTATAATGGCCCCCGGGGCTTCAGTTCTAGGGGCTTCAAGCCTCAGGGGAGAAGCGTCCACC
AGTGTTGAGCGAACCGTACCTGTCTCGCTTCTGTCCCGGGCAAAATCTCAGCTCCGGCGCCCCGCCTCTGCGATC
AACTGTACAGAGTCCAACTGCGGTGCAGACAGGACAGATGCACTATGGGCTGAGATGCAGGCCACTCTGGAGGAG
GTTGAGCTGTCCGCCTCAGGAGGCACGCATGTTTTCGGCCCGGGACATGGTCTCAAACTTGCACAGCTACGCTCC
TCTCAAATTGCCCTCGCCCAAGCATGGGCAAGAAGCGAGGCAGACGACGCGATCGAGACAGCGCTTCGCGCCAAT
GACACGACAGCGCCGGTCGATGAGGTACGAAATTTAAAAGGAGCTTGGGTAGATGCAGCTCGAAGCGGTAGTGGA
GAAGCAGCAGACCCTTCAGCCAACGCGCGACCTGAGAGTCGTGGCGATGCTGGGGCAGATCGGTTCGGGTCAAAG
TGGGAGGAGGAAACAGAAATGGATATCCTTCTCGCCAGGAATCGGCGCGAGGCAAACGACCAATATTTTAAGCGA
GTCAATAATGGCGTCATAGACGTCGTTTCAAAGTTGGAATATGTAGCCAAAGCCATGCGGGCCGTTGAGCAAGAC
AGTAGGGATGTATGGAATGAAACCGTCAACACGAGCGATCACGAGATCAATTGA
Gene >Hirsu2|4937
ATGGCGTCGACCAATCGACAGCCCGATGCCTCTCGCGAGATGACATGGGATGTCAGTGAAAATACAACAGCTCTC
CAGTCGAAGTTCAGGGGCAAGCTGCGAGAGCCCCCGCCGACCCTGTTCTTGCATCCGTCTTCGGGTGCTTCTCAT
GTCTCTCTGCCAGGTATAATGGCCCCCGGGGCTTCAGTTCTAGGGGCTTCAAGCCTCAGGGGAGAAGCGTCCACC
AGTGTTGAGCGAACCGTACCTGTCTCGCTTCTGTCCCGGGCAAAATCTCAGCTCCGGCGCCCCGCCTCTGCGATC
AACTGTACAGAGTCCAACTGCGGTGCAGACAGGACAGATGCACTATGGGCTGAGATGCAGGCCACTCTGGAGGAG
GTTGAGCTGTCCGCCTCAGGAGGCACGCATGTTTTCGGCCCGGGACATGGTCTCAAACTTGCACAGCTACGCTCC
TCTCAAATTGCCCTCGCCCAAGCATGGGCAAGAAGCGAGGCAGACGACGCGATCGAGACAGCGCTTCGCGCCAAT
GACACGACAGCGCCGGTCGATGAGGTACGAAATTTAAAAGGAGCTTGGGTAGATGCAGCTCGAAGCGGTAGTGGA
GAAGCAGCAGACCCTTCAGCCAACGCGCGACCTGAGAGTCGTGGCGATGCTGGGGCAGATCGGTTCGGGTCAAAG
TGGGAGGAGGAAACAGAAATGGATATCCTTCTCGCCAGGAATCGGCGCGAGGCAAACGACCAATATTTTAAGCGA
GTCAATAATGGCGTCATAGACGTCGTTTCAAAGTTGGAATATGTAGCCAAAGCCATGCGGGCCGTTGAGCAAGAC
AGTAGGGATGTATGGAATGAAACCGTCAACACGAGCGATCACGAGATCAATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail