Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4936
Gene name
LocationContig_2483:49..859
Strand+
Gene length (bp)810
Transcript length (bp)696
Coding sequence length (bp)696
Protein length (aa) 232

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00320 GATA GATA zinc finger 3.2E-16 180 214

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54TE3|GTAJ_DICDI GATA zinc finger domain-containing protein 10 OS=Dictyostelium discoideum GN=gtaJ PE=3 SV=1 179 221 2.0E-12
sp|Q59LY1|BRG1_CANAL Biofilm regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BRG1 PE=1 SV=1 140 216 8.0E-12
sp|B0G188|GTAP_DICDI GATA zinc finger domain-containing protein 16 OS=Dictyostelium discoideum GN=gtaP PE=3 SV=1 180 222 1.0E-11
sp|Q54TM6|GTAI_DICDI GATA zinc finger domain-containing protein 9 OS=Dictyostelium discoideum GN=gtaI PE=3 SV=1 180 218 6.0E-11
sp|Q75JZ0|GTAH_DICDI GATA zinc finger domain-containing protein 8 OS=Dictyostelium discoideum GN=gtaH PE=3 SV=1 168 211 7.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54TE3|GTAJ_DICDI GATA zinc finger domain-containing protein 10 OS=Dictyostelium discoideum GN=gtaJ PE=3 SV=1 179 221 2.0E-12
sp|Q59LY1|BRG1_CANAL Biofilm regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BRG1 PE=1 SV=1 140 216 8.0E-12
sp|B0G188|GTAP_DICDI GATA zinc finger domain-containing protein 16 OS=Dictyostelium discoideum GN=gtaP PE=3 SV=1 180 222 1.0E-11
sp|Q54TM6|GTAI_DICDI GATA zinc finger domain-containing protein 9 OS=Dictyostelium discoideum GN=gtaI PE=3 SV=1 180 218 6.0E-11
sp|Q75JZ0|GTAH_DICDI GATA zinc finger domain-containing protein 8 OS=Dictyostelium discoideum GN=gtaH PE=3 SV=1 168 211 7.0E-11
sp|Q00858|CGPB_FUSSO Cutinase gene palindrome-binding protein OS=Fusarium solani subsp. pisi PE=2 SV=1 168 217 1.0E-10
sp|Q07928|GAT3_YEAST Protein GAT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAT3 PE=3 SV=1 117 212 2.0E-10
sp|Q55EQ0|GTAF_DICDI GATA zinc finger domain-containing protein 6 OS=Dictyostelium discoideum GN=gtaF PE=3 SV=1 168 217 4.0E-10
sp|Q75JZ1|GTAC_DICDI GATA zinc finger domain-containing protein 3 OS=Dictyostelium discoideum GN=gtaC PE=3 SV=1 180 229 1.0E-09
sp|Q54HA4|GTAO_DICDI GATA zinc finger domain-containing protein 15 (Fragment) OS=Dictyostelium discoideum GN=gtaO PE=3 SV=1 110 215 2.0E-09
sp|Q54KX0|GTAN_DICDI GATA zinc finger domain-containing protein 14 OS=Dictyostelium discoideum GN=gtaN PE=3 SV=1 180 215 2.0E-09
sp|Q55GK0|GTAE_DICDI GATA zinc finger domain-containing protein 5 OS=Dictyostelium discoideum GN=gtaE PE=3 SV=1 179 224 3.0E-09
sp|Q55C49|GTAG_DICDI GATA zinc finger domain-containing protein 7 OS=Dictyostelium discoideum GN=gtaG PE=3 SV=1 180 217 4.0E-09
sp|P40209|GAT2_YEAST Protein GAT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAT2 PE=3 SV=1 180 215 5.0E-09
sp|Q5KSV0|GTAK_DICDI GATA zinc finger domain-containing protein 11 OS=Dictyostelium discoideum GN=gtaK PE=2 SV=1 179 215 6.0E-09
sp|Q54NM5|GTAL_DICDI GATA zinc finger domain-containing protein 12 OS=Dictyostelium discoideum GN=gtaL PE=3 SV=1 129 209 1.0E-08
sp|P78714|WC2_NEUCR White collar 2 protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=wc-2 PE=1 SV=1 168 210 2.0E-08
sp|Q9ZPX0|GAT20_ARATH GATA transcription factor 20 OS=Arabidopsis thaliana GN=GATA20 PE=2 SV=2 177 223 2.0E-07
sp|Q54FV1|GTAX_DICDI GATA zinc finger domain-containing protein 24 OS=Dictyostelium discoideum GN=gtaX PE=3 SV=2 170 215 2.0E-07
sp|Q54V37|GTAT_DICDI GATA zinc finger domain-containing protein 20 OS=Dictyostelium discoideum GN=gtaT PE=3 SV=1 169 218 4.0E-07
sp|Q01371|WC1_NEUCR White collar 1 protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=wc-1 PE=1 SV=2 180 211 4.0E-07
sp|Q54V32|GTAB_DICDI GATA zinc finger domain-containing protein 2 OS=Dictyostelium discoideum GN=comH PE=3 SV=1 170 215 1.0E-06
sp|Q5Z4U5|GAT20_ORYSJ GATA transcription factor 20 OS=Oryza sativa subsp. japonica GN=GATA20 PE=2 SV=1 172 218 3.0E-06
sp|Q6QPM2|GAT19_ARATH GATA transcription factor 19 OS=Arabidopsis thaliana GN=GATA19 PE=2 SV=2 179 215 4.0E-06
sp|Q9LT45|GAT29_ARATH GATA transcription factor 29 OS=Arabidopsis thaliana GN=GATA29 PE=2 SV=1 182 216 4.0E-06
sp|Q6Z433|GAT17_ORYSJ GATA transcription factor 17 OS=Oryza sativa subsp. japonica GN=GATA17 PE=2 SV=1 172 218 6.0E-06
sp|Q9FH57|GATA5_ARATH GATA transcription factor 5 OS=Arabidopsis thaliana GN=GATA5 PE=2 SV=1 176 209 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0043565 sequence-specific DNA binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0010468 regulation of gene expression No
GO:0060255 regulation of macromolecule metabolic process No
GO:0003677 DNA binding No
GO:0003674 molecular_function No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0009889 regulation of biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0008150 biological_process No
GO:0043169 cation binding No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0050794 regulation of cellular process No
GO:0019222 regulation of metabolic process No
GO:0003676 nucleic acid binding No
GO:0031326 regulation of cellular biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0065007 biological regulation No
GO:0031323 regulation of cellular metabolic process No
GO:0046914 transition metal ion binding No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0050789 regulation of biological process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0043167 ion binding No
GO:2001141 regulation of RNA biosynthetic process No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
GATA type zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4936
LPPGQVPLPSYPISPRHAVPIAPGGHYDPRAQPVHPDEADYAGRARYDASLNRHFETWSYQDSLSRIGSSSRTIF
NFAEAYTRIAREQHGSQPIPERLPTEREVGEMLANVDLIKRSLEQVKDAVQASIQSERAREGTKVKGTYEEDHDV
PMYGDGMKPQYAMQHEVKKRRGRAAPPGRCHSCNRIDTPEWRRGPDGARTLCNACGLHYAKLERKRQLEARSIRP
KPEERS*
Coding >Hirsu2|4936
CTGCCGCCCGGCCAGGTGCCGCTGCCCAGCTACCCCATCTCCCCCCGCCACGCCGTGCCCATCGCGCCCGGCGGC
CACTACGACCCCCGCGCCCAGCCCGTCCACCCGGACGAGGCCGACTACGCCGGCCGCGCCCGGTACGACGCCTCG
CTCAACCGCCACTTTGAGACGTGGAGCTACCAAGACTCCCTGAGCCGGATCGGCTCCTCGTCGCGCACCATCTTC
AACTTCGCCGAGGCCTACACGAGGATCGCGAGGGAACAGCACGGGTCGCAGCCCATCCCCGAGCGGCTGCCGACG
GAGCGCGAGGTGGGGGAGATGCTCGCCAACGTCGACCTGATCAAGCGGTCGCTCGAGCAGGTCAAGGACGCCGTC
CAGGCCTCGATCCAGAGCGAGAGGGCCCGCGAGGGGACCAAGGTCAAGGGCACCTACGAGGAGGACCACGACGTG
CCCATGTACGGCGACGGCATGAAGCCCCAGTACGCCATGCAGCACGAGGTCAAGAAGAGGCGAGGGCGAGCCGCC
CCGCCCGGCCGGTGCCACAGCTGCAATCGCATCGACACGCCCGAGTGGCGGCGAGGCCCCGACGGCGCCCGCACC
CTCTGCAACGCCTGCGGCCTGCACTACGCCAAGCTGGAGAGGAAACGCCAACTGGAGGCGCGATCGATACGGCCC
AAGCCGGAGGAGAGGAGCTAG
Transcript >Hirsu2|4936
CTGCCGCCCGGCCAGGTGCCGCTGCCCAGCTACCCCATCTCCCCCCGCCACGCCGTGCCCATCGCGCCCGGCGGC
CACTACGACCCCCGCGCCCAGCCCGTCCACCCGGACGAGGCCGACTACGCCGGCCGCGCCCGGTACGACGCCTCG
CTCAACCGCCACTTTGAGACGTGGAGCTACCAAGACTCCCTGAGCCGGATCGGCTCCTCGTCGCGCACCATCTTC
AACTTCGCCGAGGCCTACACGAGGATCGCGAGGGAACAGCACGGGTCGCAGCCCATCCCCGAGCGGCTGCCGACG
GAGCGCGAGGTGGGGGAGATGCTCGCCAACGTCGACCTGATCAAGCGGTCGCTCGAGCAGGTCAAGGACGCCGTC
CAGGCCTCGATCCAGAGCGAGAGGGCCCGCGAGGGGACCAAGGTCAAGGGCACCTACGAGGAGGACCACGACGTG
CCCATGTACGGCGACGGCATGAAGCCCCAGTACGCCATGCAGCACGAGGTCAAGAAGAGGCGAGGGCGAGCCGCC
CCGCCCGGCCGGTGCCACAGCTGCAATCGCATCGACACGCCCGAGTGGCGGCGAGGCCCCGACGGCGCCCGCACC
CTCTGCAACGCCTGCGGCCTGCACTACGCCAAGCTGGAGAGGAAACGCCAACTGGAGGCGCGATCGATACGGCCC
AAGCCGGAGGAGAGGAGCTAG
Gene >Hirsu2|4936
CTGCCGCCCGGCCAGGTGCCGCTGCCCAGCTACCCCATCTCCCCCCGCCACGCCGTGCCCATCGCGCCCGGCGGC
CACTACGACCCCCGCGCCCAGCCCGTCCACCCGGACGAGGCCGACTACGCCGGCCGCGCCCGGTACGACGCCTCG
CTCAACCGCCACTTTGAGACGTGGAGCTACCAAGACTCCCTGAGCCGGGTAGGTGGCCTGCCGCACCCCACGAGG
CCCGTGACCTGGCAAGCTGACGTCCGCAGATCGGCTCCTCGTCGCGCACCATCTTCAACTTCGCCGAGGCCTACA
CGAGGATCGCGAGGGAACAGCACGGGTCGCAGCCCATCCCCGAGCGGCTGCCGACGGAGCGCGAGGTGGGGGAGA
TGCTCGCCAACGTCGACCTGATCAAGCGGTCGCTCGAGCAGGTCAAGGACGCCGTCCAGGCCTCGATCCAGAGCG
AGAGGGCCCGCGAGGGGACCAAGGTCAAGGGCACCTACGAGGAGGACCACGACGTGCCCATGTACGGCGACGGCA
TGAAGCCCCAGTACGCCATGCAGCACGAGGTCAAGAAGAGGCGAGGGGTAAGTCGGAGAAGCATCCTTTTCCCTC
CCGGGCCCGCATACTGAGGGCCGAAAGCAGCGAGCCGCCCCGCCCGGCCGGTGCCACAGCTGCAATCGCATCGAC
ACGCCCGAGTGGCGGCGAGGCCCCGACGGCGCCCGCACCCTCTGCAACGCCTGCGGCCTGCACTACGCCAAGCTG
GAGAGGAAACGCCAACTGGAGGCGCGATCGATACGGCCCAAGCCGGAGGAGAGGAGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail