Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4930
Gene name
LocationContig_248:22582..23576
Strand+
Gene length (bp)994
Transcript length (bp)864
Coding sequence length (bp)864
Protein length (aa) 288

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01363 FYVE FYVE zinc finger 6.9E-15 160 229

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7M3|YNT3_SCHPO FYVE-type zinc finger-containing protein C9B6.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC9B6.03 PE=1 SV=1 157 287 7.0E-20
sp|Q54TC3|SLOB1_DICDI Probable inactive serine/threonine-protein kinase slob1 OS=Dictyostelium discoideum GN=slob1 PE=3 SV=1 157 234 2.0E-10
sp|O13786|PEP7_SCHPO Vacuolar segregation protein pep7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pep7 PE=3 SV=1 134 226 7.0E-10
sp|Q9Z1T6|FYV1_MOUSE 1-phosphatidylinositol 3-phosphate 5-kinase OS=Mus musculus GN=Pikfyve PE=1 SV=3 158 287 4.0E-09
sp|Q9ASS2|FREE1_ARATH Protein FREE1 OS=Arabidopsis thaliana GN=FREE1 PE=1 SV=1 142 229 9.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7M3|YNT3_SCHPO FYVE-type zinc finger-containing protein C9B6.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC9B6.03 PE=1 SV=1 157 287 7.0E-20
sp|Q54TC3|SLOB1_DICDI Probable inactive serine/threonine-protein kinase slob1 OS=Dictyostelium discoideum GN=slob1 PE=3 SV=1 157 234 2.0E-10
sp|O13786|PEP7_SCHPO Vacuolar segregation protein pep7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pep7 PE=3 SV=1 134 226 7.0E-10
sp|Q9Z1T6|FYV1_MOUSE 1-phosphatidylinositol 3-phosphate 5-kinase OS=Mus musculus GN=Pikfyve PE=1 SV=3 158 287 4.0E-09
sp|Q9ASS2|FREE1_ARATH Protein FREE1 OS=Arabidopsis thaliana GN=FREE1 PE=1 SV=1 142 229 9.0E-09
sp|Q9Y2I7|FYV1_HUMAN 1-phosphatidylinositol 3-phosphate 5-kinase OS=Homo sapiens GN=PIKFYVE PE=1 SV=3 158 287 1.0E-08
sp|Q9BQS8|FYCO1_HUMAN FYVE and coiled-coil domain-containing protein 1 OS=Homo sapiens GN=FYCO1 PE=1 SV=3 147 275 1.0E-08
sp|P53191|PIB2_YEAST Phosphatidylinositol 3-phosphate-binding protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIB2 PE=1 SV=1 156 232 2.0E-08
sp|Q69ZL1|FGD6_MOUSE FYVE, RhoGEF and PH domain-containing protein 6 OS=Mus musculus GN=Fgd6 PE=1 SV=2 161 259 9.0E-08
sp|B0G126|FYV1_DICDI 1-phosphatidylinositol 3-phosphate 5-kinase OS=Dictyostelium discoideum GN=pip5k3 PE=3 SV=1 158 234 2.0E-07
sp|B4JHI7|LST2_DROGR Lateral signaling target protein 2 homolog OS=Drosophila grimshawi GN=GH18624 PE=3 SV=1 161 240 6.0E-07
sp|Q6CL17|VPS27_KLULA Vacuolar protein sorting-associated protein 27 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=VPS27 PE=3 SV=1 174 228 6.0E-07
sp|O96838|FYV1_DROME Putative 1-phosphatidylinositol 3-phosphate 5-kinase OS=Drosophila melanogaster GN=fab1 PE=1 SV=2 158 280 6.0E-07
sp|B4M140|LST2_DROVI Lateral signaling target protein 2 homolog OS=Drosophila virilis GN=GJ23073 PE=3 SV=1 161 248 7.0E-07
sp|Q6ZV73|FGD6_HUMAN FYVE, RhoGEF and PH domain-containing protein 6 OS=Homo sapiens GN=FGD6 PE=1 SV=2 161 259 7.0E-07
sp|Q9LUM0|FAB1B_ARATH 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B OS=Arabidopsis thaliana GN=FAB1B PE=2 SV=1 154 228 9.0E-07
sp|P40343|VPS27_YEAST Vacuolar protein sorting-associated protein 27 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS27 PE=1 SV=3 174 228 1.0E-06
sp|Q8VDC1|FYCO1_MOUSE FYVE and coiled-coil domain-containing protein 1 OS=Mus musculus GN=Fyco1 PE=1 SV=1 164 275 1.0E-06
sp|Q755J9|VPS27_ASHGO Vacuolar protein sorting-associated protein 27 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VPS27 PE=3 SV=1 174 228 1.0E-06
sp|A3LX75|VPS27_PICST Vacuolar protein sorting-associated protein 27 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=VPS27 PE=3 SV=2 140 231 1.0E-06
sp|P34756|FAB1_YEAST 1-phosphatidylinositol 3-phosphate 5-kinase FAB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAB1 PE=1 SV=3 157 249 3.0E-06
sp|Q06651|PIB1_YEAST E3 ubiquitin-protein ligase PIB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIB1 PE=1 SV=1 161 269 3.0E-06
sp|Q0P4S0|LST2_XENTR Lateral signaling target protein 2 homolog OS=Xenopus tropicalis GN=zfyve28 PE=2 SV=1 161 226 3.0E-06
sp|Q0WUR5|FAB1A_ARATH 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A OS=Arabidopsis thaliana GN=FAB1A PE=2 SV=1 157 228 3.0E-06
sp|Q6ZPK7|LST2_MOUSE Lateral signaling target protein 2 homolog OS=Mus musculus GN=Zfyve28 PE=1 SV=2 160 226 4.0E-06
sp|B4K982|LST2_DROMO Lateral signaling target protein 2 homolog OS=Drosophila mojavensis GN=GI24295 PE=3 SV=1 161 231 5.0E-06
sp|Q9HCC9|LST2_HUMAN Lateral signaling target protein 2 homolog OS=Homo sapiens GN=ZFYVE28 PE=1 SV=3 160 226 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4930
MAADLVMPAPRGHDPQAWQFPPPNRPHHNRSQSYRAASGPQISPLSVSDASSNQTVSMPPSPTAHYTYQGRPMYI
PAVLRPCDEFPSKKIMRRKTGGSTSDSDSDTPLRRVNSNLMGLAALGTLSHRLGRRPHGDSVSLLEGDWNLDAFP
EVTALPTRKHWKPDPQSSVCDDPTCKRNFSYFVRRHHCRKCGNIFCDWHSNLVLPLDQDANFNPRAALSRACNHC
FREAKALHDRRNSQSSASTASDAPHRTTPAAVSAPPNGTAPTAPRPQDMAASVPRDWNWSTF*
Coding >Hirsu2|4930
ATGGCCGCCGATCTCGTCATGCCCGCACCGCGCGGCCACGATCCCCAAGCCTGGCAGTTCCCGCCGCCAAACCGC
CCCCATCACAACCGGTCGCAGTCGTACCGCGCCGCCTCCGGGCCCCAAATCTCCCCGCTCAGCGTCTCCGACGCC
AGCAGCAACCAGACGGTGTCGATGCCCCCGTCCCCGACGGCGCACTACACATACCAGGGCCGCCCGATGTACATA
CCCGCCGTCCTGCGTCCATGCGACGAGTTTCCCTCCAAGAAGATCATGCGCCGCAAGACGGGCGGCTCGACGTCC
GACTCCGACTCGGACACGCCGCTGCGCCGCGTCAACTCCAACCTCATGGGCCTGGCCGCCCTCGGCACGCTGAGC
CATCGGCTGGGTCGACGCCCGCACGGCGACAGCGTCAGCCTCTTGGAGGGAGACTGGAATCTCGACGCCTTCCCC
GAGGTGACGGCCCTGCCGACGCGCAAGCACTGGAAACCCGACCCCCAGTCCTCGGTCTGCGACGATCCGACCTGC
AAGCGCAACTTCAGCTACTTCGTCCGACGCCACCACTGTCGCAAGTGCGGCAACATCTTCTGCGACTGGCACTCC
AACCTGGTCCTGCCGCTCGACCAGGACGCCAACTTCAACCCGCGCGCGGCCCTGTCCCGGGCCTGCAACCACTGC
TTCCGCGAAGCCAAGGCGCTGCACGACCGGCGCAACAGCCAGTCGTCGGCCTCGACGGCCTCGGACGCGCCGCAC
AGGACGACGCCCGCCGCCGTGTCGGCGCCGCCCAACGGCACCGCGCCCACGGCGCCTCGCCCCCAGGACATGGCC
GCCAGCGTGCCGCGCGACTGGAACTGGAGCACCTTCTAG
Transcript >Hirsu2|4930
ATGGCCGCCGATCTCGTCATGCCCGCACCGCGCGGCCACGATCCCCAAGCCTGGCAGTTCCCGCCGCCAAACCGC
CCCCATCACAACCGGTCGCAGTCGTACCGCGCCGCCTCCGGGCCCCAAATCTCCCCGCTCAGCGTCTCCGACGCC
AGCAGCAACCAGACGGTGTCGATGCCCCCGTCCCCGACGGCGCACTACACATACCAGGGCCGCCCGATGTACATA
CCCGCCGTCCTGCGTCCATGCGACGAGTTTCCCTCCAAGAAGATCATGCGCCGCAAGACGGGCGGCTCGACGTCC
GACTCCGACTCGGACACGCCGCTGCGCCGCGTCAACTCCAACCTCATGGGCCTGGCCGCCCTCGGCACGCTGAGC
CATCGGCTGGGTCGACGCCCGCACGGCGACAGCGTCAGCCTCTTGGAGGGAGACTGGAATCTCGACGCCTTCCCC
GAGGTGACGGCCCTGCCGACGCGCAAGCACTGGAAACCCGACCCCCAGTCCTCGGTCTGCGACGATCCGACCTGC
AAGCGCAACTTCAGCTACTTCGTCCGACGCCACCACTGTCGCAAGTGCGGCAACATCTTCTGCGACTGGCACTCC
AACCTGGTCCTGCCGCTCGACCAGGACGCCAACTTCAACCCGCGCGCGGCCCTGTCCCGGGCCTGCAACCACTGC
TTCCGCGAAGCCAAGGCGCTGCACGACCGGCGCAACAGCCAGTCGTCGGCCTCGACGGCCTCGGACGCGCCGCAC
AGGACGACGCCCGCCGCCGTGTCGGCGCCGCCCAACGGCACCGCGCCCACGGCGCCTCGCCCCCAGGACATGGCC
GCCAGCGTGCCGCGCGACTGGAACTGGAGCACCTTCTAG
Gene >Hirsu2|4930
ATGGCCGCCGATCTCGTCATGCCCGCACCGCGCGGCCACGATCCCCAAGCCTGGCAGTTCCCGCCGCCAAACCGC
CCCCATCACAACCGGTCGCAGTCGTACCGCGCCGCCTCCGGGCCCCAAATCTCCCCGCTCAGCGTCTCCGACGCC
AGCAGCAACCAGACGGTGTCGATGCCCCCGTCCCCGACGGCGCACTACACATACCAGGGCCGCCCGATGTACATA
CCCGCCGTCCTGCGTCCATGCGACGAGTTTCCCTCCAAGAAGATCATGCGCCGCAAGACGGGCGGCTCGACGTCC
GACTCCGACTCGGACACGCCGCTGCGCCGCGTCAACTCCAACCTCATGGGCCTGGCCGCCCTCGGCACGCTGAGC
CATCGGCTGGGTCGACGCCCGCACGGCGACAGCGTCAGCCTCTTGGAGGGAGACTGGAATCTCGACGCCTTCCCC
GAGGTGACGGCCCTGCCGACGCGCAAGCACTGGAAAGTGAGTCCTCTTTCTTCCCTTTTTCGTCGCCCGACGCCT
CGAGCCGCCGACGCCGCACCTGAGCTTTTGGTCTCGTCGTGCATATCGGCCCTGATTGCGCACGCTCGCGCTAAC
CGCGTCCATCGACCAGCCCGACCCCCAGTCCTCGGTCTGCGACGATCCGACCTGCAAGCGCAACTTCAGCTACTT
CGTCCGACGCCACCACTGTCGCAAGTGCGGCAACATCTTCTGCGACTGGCACTCCAACCTGGTCCTGCCGCTCGA
CCAGGACGCCAACTTCAACCCGCGCGCGGCCCTGTCCCGGGCCTGCAACCACTGCTTCCGCGAAGCCAAGGCGCT
GCACGACCGGCGCAACAGCCAGTCGTCGGCCTCGACGGCCTCGGACGCGCCGCACAGGACGACGCCCGCCGCCGT
GTCGGCGCCGCCCAACGGCACCGCGCCCACGGCGCCTCGCCCCCAGGACATGGCCGCCAGCGTGCCGCGCGACTG
GAACTGGAGCACCTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail