Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|493
Gene name
LocationContig_11:3809..5560
Strand-
Gene length (bp)1751
Transcript length (bp)1617
Coding sequence length (bp)1617
Protein length (aa) 539

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03198 Glyco_hydro_72 Glucanosyltransferase 9.9E-124 18 331
PF07983 X8 X8 domain 6.0E-23 382 457

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4ATC3|GAS1_ARTBC 1,3-beta-glucanosyltransferase ARB_07487 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07487 PE=1 SV=1 1 538 0.0E+00
sp|P0C956|GEL4_ASPFU 1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gel4 PE=3 SV=1 10 538 8.0E-161
sp|B0XVI5|GEL4_ASPFC 1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=gel4 PE=1 SV=1 10 538 8.0E-161
sp|P43076|PHR1_CANAL pH-responsive protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PHR1 PE=2 SV=3 9 461 1.0E-152
sp|P56092|EPD1_CANMA Protein EPD1 OS=Candida maltosa GN=EPD1 PE=3 SV=1 1 460 7.0E-150
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4ATC3|GAS1_ARTBC 1,3-beta-glucanosyltransferase ARB_07487 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07487 PE=1 SV=1 1 538 0.0E+00
sp|P0C956|GEL4_ASPFU 1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gel4 PE=3 SV=1 10 538 8.0E-161
sp|B0XVI5|GEL4_ASPFC 1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=gel4 PE=1 SV=1 10 538 8.0E-161
sp|P43076|PHR1_CANAL pH-responsive protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PHR1 PE=2 SV=3 9 461 1.0E-152
sp|P56092|EPD1_CANMA Protein EPD1 OS=Candida maltosa GN=EPD1 PE=3 SV=1 1 460 7.0E-150
sp|O13318|PHR2_CANAL pH-responsive protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PHR2 PE=2 SV=2 1 475 3.0E-149
sp|O74137|EPD2_CANMA Protein EPD2 OS=Candida maltosa GN=EPD2 PE=3 SV=1 23 460 4.0E-147
sp|P22146|GAS1_YEAST 1,3-beta-glucanosyltransferase GAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAS1 PE=1 SV=2 2 492 4.0E-145
sp|P0C955|GEL3_ASPFU 1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gel3 PE=3 SV=1 29 475 3.0E-141
sp|B0XT09|GEL3_ASPFC 1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=gel3 PE=1 SV=1 29 475 4.0E-141
sp|Q06135|GAS2_YEAST 1,3-beta-glucanosyltransferase GAS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAS2 PE=1 SV=1 6 456 2.0E-125
sp|Q9P378|GAS1_SCHPO 1,3-beta-glucanosyltransferase gas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gas1 PE=1 SV=1 5 475 9.0E-123
sp|Q59VW6|PGA5_CANAL 1,3-beta-glucanosyltransferase PGA5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PGA5 PE=1 SV=1 18 456 2.0E-108
sp|Q9USU5|GAS2_SCHPO 1,3-beta-glucanosyltransferase gas2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gas2 PE=2 SV=1 1 455 1.0E-101
sp|Q08193|GAS5_YEAST 1,3-beta-glucanosyltransferase GAS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAS5 PE=1 SV=1 1 369 2.0E-92
sp|P0C7S9|GEL1_ASPFU 1,3-beta-glucanosyltransferase gel1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gel1 PE=3 SV=1 1 370 4.0E-78
sp|B0XT72|GEL1_ASPFC 1,3-beta-glucanosyltransferase gel1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=gel1 PE=1 SV=1 1 370 5.0E-78
sp|O13692|GAS5_SCHPO 1,3-beta-glucanosyltransferase gas5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gas5 PE=1 SV=1 25 372 8.0E-78
sp|Q5AJY5|PGA4_CANAL 1,3-beta-glucanosyltransferase PGA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PGA4 PE=1 SV=1 3 373 3.0E-76
sp|Q9Y7Y7|GAS4_SCHPO 1,3-beta-glucanosyltransferase gas4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gas4 PE=1 SV=1 1 370 6.0E-74
sp|P0C954|GEL2_ASPFU 1,3-beta-glucanosyltransferase gel2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gel2 PE=3 SV=1 1 351 2.0E-66
sp|B0Y8H9|GEL2_ASPFC 1,3-beta-glucanosyltransferase gel2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=gel2 PE=1 SV=1 1 351 2.0E-66
sp|Q08271|GAS4_YEAST 1,3-beta-glucanosyltransferase GAS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAS4 PE=1 SV=1 1 331 3.0E-66
sp|Q03655|GAS3_YEAST Probable 1,3-beta-glucanosyltransferase GAS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAS3 PE=1 SV=1 1 340 1.0E-57
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 514 536 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|493
MALTKLSLSLLAAAGSVLAADLPRVQIKGSKFFHENGTQFFIKGVAYQQDTSAGGATSENTNKYIDPLSDLERCK
RDVPLLQELGTNTIRTYAIDPTADHSGCMRLLNDAGIYIVSDLSEPAVSINRDNPQWDVQTFDRYKKVVDELCRY
PNVIGLFAGNEVSNNKTNTGASAFVKAAVRDTKAYIKSKKDCQMGVGYAANDDADIRKDIADYFNCGKPEDAIDF
WGYNIYSWCGKSDMQKSGYTQQTKFFEDYSVPVFFAEYGCNIPSGAEGRIFDETAALYSDEMTKVFSGGIVYMYF
QEENDYGLVKVQGNKATRMKNFQALKEQVTNSTPKAVERDSYNPTNQPQKCPDPKAGSWHANEALPPTPDQSLCD
CMVKSRSCVQRSGITPKDYGKIFGYICGAEPEICTGIQGNASTGVYGAYSMCSDSAKLDYVLDTYYTKQKKASTA
CDFDGKAGVQSGNVESSCSDKLARASDINRQVATATAPVGGGGSSPTETSDSFAVPGAPMVRLFTAGDFAMGLYM
AVAVVAGVAMVAL*
Coding >Hirsu2|493
ATGGCCCTCACCAAGCTATCCCTGTCGCTCCTGGCCGCGGCCGGGAGCGTCCTCGCTGCCGACTTGCCGAGAGTC
CAGATAAAGGGATCCAAGTTCTTCCACGAGAACGGCACCCAGTTCTTCATAAAGGGTGTTGCTTACCAGCAGGAC
ACGAGCGCGGGCGGCGCCACGAGCGAAAACACCAACAAGTACATCGACCCGCTGTCCGACCTGGAGAGGTGCAAG
CGTGATGTCCCTCTGCTCCAGGAGCTCGGCACCAACACGATCCGGACGTATGCCATCGACCCCACGGCAGACCAC
TCGGGCTGCATGCGCCTGCTCAACGACGCCGGCATCTACATCGTCTCCGACCTCAGCGAGCCCGCCGTCTCCATC
AACCGCGACAATCCCCAGTGGGACGTCCAGACCTTTGACCGCTACAAGAAGGTCGTCGACGAGCTCTGCCGCTAC
CCCAACGTCATCGGCCTCTTCGCCGGCAACGAGGTCAGCAACAACAAGACAAACACGGGCGCCTCGGCCTTCGTC
AAGGCCGCCGTCCGCGACACCAAGGCCTACATCAAGAGCAAGAAGGACTGCCAGATGGGCGTCGGCTACGCTGCC
AACGATGACGCCGACATCCGCAAGGACATTGCCGACTACTTCAACTGCGGCAAGCCCGAGGACGCCATCGACTTC
TGGGGTTACAACATCTACTCGTGGTGCGGCAAGAGCGACATGCAAAAGTCGGGCTACACCCAGCAGACCAAGTTC
TTCGAGGACTACTCCGTCCCCGTCTTCTTCGCCGAGTACGGCTGCAACATCCCCAGCGGCGCCGAGGGCCGTATA
TTCGACGAGACCGCCGCCCTCTATTCCGACGAGATGACCAAGGTCTTCTCCGGCGGCATCGTCTACATGTACTTC
CAGGAGGAGAACGACTACGGTCTGGTCAAGGTGCAGGGCAACAAGGCGACGAGGATGAAGAACTTCCAGGCGCTC
AAGGAGCAGGTGACGAATTCGACGCCCAAGGCCGTCGAGCGCGACTCGTACAACCCCACCAACCAGCCGCAGAAG
TGCCCCGACCCCAAGGCGGGCAGCTGGCACGCCAACGAGGCGCTCCCGCCGACGCCGGACCAGTCGCTGTGCGAC
TGCATGGTCAAGTCGCGCAGCTGCGTGCAGCGGTCCGGCATCACGCCCAAGGACTACGGCAAGATCTTCGGCTAC
ATCTGCGGCGCGGAGCCCGAGATCTGCACGGGCATCCAGGGCAACGCGTCGACGGGCGTCTACGGCGCCTACAGC
ATGTGTTCGGACAGCGCCAAGCTCGACTACGTGCTGGACACCTACTACACCAAGCAGAAGAAGGCTTCGACCGCG
TGCGACTTCGACGGCAAGGCGGGCGTCCAGAGCGGCAACGTGGAGAGCTCGTGCAGCGACAAGCTGGCCAGGGCC
AGCGACATCAACCGGCAGGTGGCGACGGCAACGGCGCCCGTCGGCGGCGGCGGCTCCAGCCCGACGGAGACGAGC
GACAGCTTCGCCGTGCCCGGGGCGCCCATGGTCCGCCTGTTCACGGCCGGCGACTTCGCCATGGGGCTGTACATG
GCCGTGGCCGTGGTGGCCGGTGTCGCGATGGTTGCGCTGTAA
Transcript >Hirsu2|493
ATGGCCCTCACCAAGCTATCCCTGTCGCTCCTGGCCGCGGCCGGGAGCGTCCTCGCTGCCGACTTGCCGAGAGTC
CAGATAAAGGGATCCAAGTTCTTCCACGAGAACGGCACCCAGTTCTTCATAAAGGGTGTTGCTTACCAGCAGGAC
ACGAGCGCGGGCGGCGCCACGAGCGAAAACACCAACAAGTACATCGACCCGCTGTCCGACCTGGAGAGGTGCAAG
CGTGATGTCCCTCTGCTCCAGGAGCTCGGCACCAACACGATCCGGACGTATGCCATCGACCCCACGGCAGACCAC
TCGGGCTGCATGCGCCTGCTCAACGACGCCGGCATCTACATCGTCTCCGACCTCAGCGAGCCCGCCGTCTCCATC
AACCGCGACAATCCCCAGTGGGACGTCCAGACCTTTGACCGCTACAAGAAGGTCGTCGACGAGCTCTGCCGCTAC
CCCAACGTCATCGGCCTCTTCGCCGGCAACGAGGTCAGCAACAACAAGACAAACACGGGCGCCTCGGCCTTCGTC
AAGGCCGCCGTCCGCGACACCAAGGCCTACATCAAGAGCAAGAAGGACTGCCAGATGGGCGTCGGCTACGCTGCC
AACGATGACGCCGACATCCGCAAGGACATTGCCGACTACTTCAACTGCGGCAAGCCCGAGGACGCCATCGACTTC
TGGGGTTACAACATCTACTCGTGGTGCGGCAAGAGCGACATGCAAAAGTCGGGCTACACCCAGCAGACCAAGTTC
TTCGAGGACTACTCCGTCCCCGTCTTCTTCGCCGAGTACGGCTGCAACATCCCCAGCGGCGCCGAGGGCCGTATA
TTCGACGAGACCGCCGCCCTCTATTCCGACGAGATGACCAAGGTCTTCTCCGGCGGCATCGTCTACATGTACTTC
CAGGAGGAGAACGACTACGGTCTGGTCAAGGTGCAGGGCAACAAGGCGACGAGGATGAAGAACTTCCAGGCGCTC
AAGGAGCAGGTGACGAATTCGACGCCCAAGGCCGTCGAGCGCGACTCGTACAACCCCACCAACCAGCCGCAGAAG
TGCCCCGACCCCAAGGCGGGCAGCTGGCACGCCAACGAGGCGCTCCCGCCGACGCCGGACCAGTCGCTGTGCGAC
TGCATGGTCAAGTCGCGCAGCTGCGTGCAGCGGTCCGGCATCACGCCCAAGGACTACGGCAAGATCTTCGGCTAC
ATCTGCGGCGCGGAGCCCGAGATCTGCACGGGCATCCAGGGCAACGCGTCGACGGGCGTCTACGGCGCCTACAGC
ATGTGTTCGGACAGCGCCAAGCTCGACTACGTGCTGGACACCTACTACACCAAGCAGAAGAAGGCTTCGACCGCG
TGCGACTTCGACGGCAAGGCGGGCGTCCAGAGCGGCAACGTGGAGAGCTCGTGCAGCGACAAGCTGGCCAGGGCC
AGCGACATCAACCGGCAGGTGGCGACGGCAACGGCGCCCGTCGGCGGCGGCGGCTCCAGCCCGACGGAGACGAGC
GACAGCTTCGCCGTGCCCGGGGCGCCCATGGTCCGCCTGTTCACGGCCGGCGACTTCGCCATGGGGCTGTACATG
GCCGTGGCCGTGGTGGCCGGTGTCGCGATGGTTGCGCTGTAA
Gene >Hirsu2|493
ATGGCCCTCACCAAGCTATCCCTGTCGCTCCTGGCCGCGGCCGGGAGCGTCCTCGCTGCCGACTTGCCGAGAGTC
CAGATAAAGGTAGCGCTGCGTCGCAACCTGCCCTTCGCCGCCTCGCGGGCCGCTGCTTACCAGTCTTCCACTCCA
GGGATCCAAGTTCTTCCACGAGAACGGCACCCAGTTCTTCATAAAGGGTGTTGCTTACCAGCAGGACACGAGCGC
GGGCGGCGCCACGAGCGAAAACACCAACAAGTACATCGACCCGCTGTCCGACCTGGAGAGGTGCAAGCGTGATGT
CCCTCTGCTCCAGGAGCTCGGCACCAACACGATCCGGACGTATGCCATCGACCCCACGGCAGACCACTCGGGCTG
CATGCGCCTGCTCAACGACGCCGGCATCTACATCGTCTCCGACCTCAGCGAGCCCGCCGTCTCCATCAACCGCGA
CAATCCCCAGTGGGACGTCCAGACCTTTGACCGCTACAAGAAGGTCGTCGACGAGCTCTGCCGCTACCCCAACGT
CATCGGCCTCTTCGCCGGCAACGAGGTCAGCAACAACAAGACAAACACGGGCGCCTCGGCCTTCGTCAAGGCCGC
CGTCCGCGACACCAAGGCCTACATCAAGAGCAAGAAGGACTGCCAGATGGGCGTCGGCTACGCTGCCAACGATGA
CGCCGACATCCGCAAGGACATTGCCGACTACTTCAACTGCGGCAAGCCCGAGGACGCCATCGACTTCTGGGGTTA
CAACATCTACTCGTGGTGCGGCAAGAGCGACATGCAAAAGTCGGGCTACACCCAGCAGACCAAGTTCTTCGAGGA
CTACTCCGTCCCCGTCTTCTTCGCCGAGTACGGCTGCAACATCCCCAGCGGCGCCGAGGGCCGTATATTCGACGA
GACCGCCGCCCTCTATTCCGACGAGATGACCAAGGTCTTCTCCGGCGGCATCGTCTACATGTACTTCCAGGAGGA
GAACGACTACGGTAAGCCCCTCTCTGCCGCCTCGCCTCGGCCTGTCCACGCGCTGATGACTTGTCCCCCCACAAT
CAGGTCTGGTCAAGGTGCAGGGCAACAAGGCGACGAGGATGAAGAACTTCCAGGCGCTCAAGGAGCAGGTGACGA
ATTCGACGCCCAAGGCCGTCGAGCGCGACTCGTACAACCCCACCAACCAGCCGCAGAAGTGCCCCGACCCCAAGG
CGGGCAGCTGGCACGCCAACGAGGCGCTCCCGCCGACGCCGGACCAGTCGCTGTGCGACTGCATGGTCAAGTCGC
GCAGCTGCGTGCAGCGGTCCGGCATCACGCCCAAGGACTACGGCAAGATCTTCGGCTACATCTGCGGCGCGGAGC
CCGAGATCTGCACGGGCATCCAGGGCAACGCGTCGACGGGCGTCTACGGCGCCTACAGCATGTGTTCGGACAGCG
CCAAGCTCGACTACGTGCTGGACACCTACTACACCAAGCAGAAGAAGGCTTCGACCGCGTGCGACTTCGACGGCA
AGGCGGGCGTCCAGAGCGGCAACGTGGAGAGCTCGTGCAGCGACAAGCTGGCCAGGGCCAGCGACATCAACCGGC
AGGTGGCGACGGCAACGGCGCCCGTCGGCGGCGGCGGCTCCAGCCCGACGGAGACGAGCGACAGCTTCGCCGTGC
CCGGGGCGCCCATGGTCCGCCTGTTCACGGCCGGCGACTTCGCCATGGGGCTGTACATGGCCGTGGCCGTGGTGG
CCGGTGTCGCGATGGTTGCGCTGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail