Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4924
Gene name
LocationContig_248:2607..3551
Strand-
Gene length (bp)944
Transcript length (bp)807
Coding sequence length (bp)807
Protein length (aa) 269

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01709 Transcrip_reg Transcriptional regulator 3.8E-60 10 249

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3A233|Y2335_PELCD Probable transcriptional regulatory protein Pcar_2335 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=Pcar_2335 PE=3 SV=1 6 264 2.0E-28
sp|A0LUK8|Y1346_ACIC1 Probable transcriptional regulatory protein Acel_1346 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=Acel_1346 PE=3 SV=1 6 248 5.0E-28
sp|B8DUF0|Y1344_BIFA0 Probable transcriptional regulatory protein BLA_1344 OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=BLA_1344 PE=3 SV=1 6 226 1.0E-27
sp|C5C5Q3|Y1989_BEUC1 Probable transcriptional regulatory protein Bcav_1989 OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=Bcav_1989 PE=3 SV=1 6 248 2.0E-26
sp|Q9L288|Y1521_STRCO Probable transcriptional regulatory protein SCO1521 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO1521 PE=3 SV=1 6 248 2.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3A233|Y2335_PELCD Probable transcriptional regulatory protein Pcar_2335 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=Pcar_2335 PE=3 SV=1 6 264 2.0E-28
sp|A0LUK8|Y1346_ACIC1 Probable transcriptional regulatory protein Acel_1346 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=Acel_1346 PE=3 SV=1 6 248 5.0E-28
sp|B8DUF0|Y1344_BIFA0 Probable transcriptional regulatory protein BLA_1344 OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=BLA_1344 PE=3 SV=1 6 226 1.0E-27
sp|C5C5Q3|Y1989_BEUC1 Probable transcriptional regulatory protein Bcav_1989 OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=Bcav_1989 PE=3 SV=1 6 248 2.0E-26
sp|Q9L288|Y1521_STRCO Probable transcriptional regulatory protein SCO1521 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO1521 PE=3 SV=1 6 248 2.0E-26
sp|A4TD17|Y3828_MYCGI Probable transcriptional regulatory protein Mflv_3828 OS=Mycobacterium gilvum (strain PYR-GCK) GN=Mflv_3828 PE=3 SV=1 6 249 5.0E-26
sp|B6IYU5|Y446_COXB2 Probable transcriptional regulatory protein CbuG_0446 OS=Coxiella burnetii (strain CbuG_Q212) GN=CbuG_0446 PE=3 SV=1 6 248 7.0E-26
sp|A9KF43|Y422_COXBN Probable transcriptional regulatory protein CBUD_0422 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=CBUD_0422 PE=3 SV=1 6 248 7.0E-26
sp|B6J503|Y1793_COXB1 Probable transcriptional regulatory protein CbuK_1793 OS=Coxiella burnetii (strain CbuK_Q154) GN=CbuK_1793 PE=3 SV=1 6 248 7.0E-26
sp|A9N9A0|Y1752_COXBR Probable transcriptional regulatory protein COXBURSA331_A1752 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=COXBURSA331_A1752 PE=3 SV=1 6 248 7.0E-26
sp|Q83BE4|Y1566_COXBU Probable transcriptional regulatory protein CBU_1566 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=CBU_1566 PE=1 SV=1 6 248 7.0E-26
sp|A1UF88|Y2298_MYCSK Probable transcriptional regulatory protein Mkms_2298 OS=Mycobacterium sp. (strain KMS) GN=Mkms_2298 PE=3 SV=1 6 248 1.0E-25
sp|A3PYU9|Y2290_MYCSJ Probable transcriptional regulatory protein Mjls_2290 OS=Mycobacterium sp. (strain JLS) GN=Mjls_2290 PE=3 SV=1 6 248 1.0E-25
sp|Q1B9S5|Y2251_MYCSS Probable transcriptional regulatory protein Mmcs_2251 OS=Mycobacterium sp. (strain MCS) GN=Mmcs_2251 PE=3 SV=1 6 248 1.0E-25
sp|A0QWH1|Y2940_MYCS2 Probable transcriptional regulatory protein MSMEG_2940/MSMEI_2866 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_2940 PE=1 SV=1 6 249 1.0E-25
sp|Q39XN9|Y743_GEOMG Probable transcriptional regulatory protein Gmet_0743 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=Gmet_0743 PE=3 SV=1 6 248 1.0E-25
sp|C0QT62|Y079_PERMH Probable transcriptional regulatory protein PERMA_0079 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=PERMA_0079 PE=3 SV=1 6 248 1.0E-25
sp|Q0RNU9|Y2138_FRAAA Probable transcriptional regulatory protein FRAAL2138 OS=Frankia alni (strain ACN14a) GN=FRAAL2138 PE=3 SV=1 6 257 2.0E-25
sp|Q2Y5G2|Y2722_NITMU Probable transcriptional regulatory protein Nmul_A2722 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=Nmul_A2722 PE=3 SV=1 6 242 3.0E-25
sp|P67178|Y2635_MYCBO Probable transcriptional regulatory protein Mb2635c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2635c PE=3 SV=1 6 249 4.0E-25
sp|A5U5V4|Y2631_MYCTA Probable transcriptional regulatory protein MRA_2631 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_2631 PE=3 SV=1 6 249 4.0E-25
sp|A1KLV3|Y2628_MYCBP Probable transcriptional regulatory protein BCG_2628c OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_2628c PE=3 SV=1 6 249 4.0E-25
sp|C1AF74|Y2622_MYCBT Probable transcriptional regulatory protein JTY_2622 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=JTY_2622 PE=3 SV=1 6 249 4.0E-25
sp|P9WGA5|Y2603_MYCTU Probable transcriptional regulatory protein Rv2603c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2603c PE=1 SV=1 6 249 4.0E-25
sp|P9WGA4|Y2603_MYCTO Probable transcriptional regulatory protein MT2678 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2678 PE=3 SV=1 6 249 4.0E-25
sp|A4WQ19|Y577_RHOS5 Probable transcriptional regulatory protein Rsph17025_0577 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=Rsph17025_0577 PE=3 SV=1 6 248 4.0E-25
sp|O43075|YGWC_SCHPO Probable transcriptional regulatory protein C8D2.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi053 PE=3 SV=2 6 249 6.0E-25
sp|Q0VRK0|Y750_ALCBS Probable transcriptional regulatory protein ABO_0750 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=ABO_0750 PE=3 SV=1 6 248 8.0E-25
sp|B2S369|Y474_TREPS Probable transcriptional regulatory protein TPASS_0474 OS=Treponema pallidum subsp. pallidum (strain SS14) GN=TPASS_0474 PE=3 SV=1 6 248 9.0E-25
sp|O83487|Y474_TREPA Probable transcriptional regulatory protein TP_0474 OS=Treponema pallidum (strain Nichols) GN=TP_0474 PE=3 SV=1 6 248 9.0E-25
sp|O67517|Y1575_AQUAE Probable transcriptional regulatory protein aq_1575 OS=Aquifex aeolicus (strain VF5) GN=aq_1575 PE=1 SV=1 6 248 1.0E-24
sp|A0QIC5|Y3481_MYCA1 Probable transcriptional regulatory protein MAV_3481 OS=Mycobacterium avium (strain 104) GN=MAV_3481 PE=3 SV=1 6 248 1.0E-24
sp|Q47N40|Y2096_THEFY Probable transcriptional regulatory protein Tfu_2096 OS=Thermobifida fusca (strain YX) GN=Tfu_2096 PE=3 SV=1 6 248 1.0E-24
sp|C6E1T1|Y933_GEOSM Probable transcriptional regulatory protein GM21_0933 OS=Geobacter sp. (strain M21) GN=GM21_0933 PE=3 SV=1 6 248 1.0E-24
sp|A6WCI2|Y3057_KINRD Probable transcriptional regulatory protein Krad_3057 OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=Krad_3057 PE=3 SV=1 6 248 2.0E-24
sp|B9L8T4|Y626_NAUPA Probable transcriptional regulatory protein NAMH_0626 OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=NAMH_0626 PE=3 SV=1 6 249 2.0E-24
sp|B5EAH0|Y3313_GEOBB Probable transcriptional regulatory protein Gbem_3313 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=Gbem_3313 PE=3 SV=1 6 248 2.0E-24
sp|A1ASF6|Y2673_PELPD Probable transcriptional regulatory protein Ppro_2673 OS=Pelobacter propionicus (strain DSM 2379) GN=Ppro_2673 PE=3 SV=1 6 248 2.0E-24
sp|A1T879|Y2570_MYCVP Probable transcriptional regulatory protein Mvan_2570 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=Mvan_2570 PE=3 SV=1 6 249 2.0E-24
sp|Q827T9|Y6832_STRAW Probable transcriptional regulatory protein SAV_6832 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=SAV_6832 PE=3 SV=1 6 248 2.0E-24
sp|B4U7S7|Y501_HYDS0 Probable transcriptional regulatory protein HY04AAS1_0501 OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=HY04AAS1_0501 PE=3 SV=1 6 248 3.0E-24
sp|A0PSY4|Y3246_MYCUA Probable transcriptional regulatory protein MUL_3246 OS=Mycobacterium ulcerans (strain Agy99) GN=MUL_3246 PE=3 SV=1 6 249 3.0E-24
sp|B2HN50|Y2098_MYCMM Probable transcriptional regulatory protein MMAR_2098 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=MMAR_2098 PE=3 SV=1 6 249 3.0E-24
sp|A3PM44|Y2308_RHOS1 Probable transcriptional regulatory protein Rsph17029_2308 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=Rsph17029_2308 PE=3 SV=1 6 248 3.0E-24
sp|Q8EEF0|Y2432_SHEON Probable transcriptional regulatory protein SO_2432 OS=Shewanella oneidensis (strain MR-1) GN=SO_2432 PE=3 SV=1 6 248 3.0E-24
sp|B1W3G1|Y6014_STRGG Probable transcriptional regulatory protein SGR_6014 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=SGR_6014 PE=3 SV=1 6 248 4.0E-24
sp|Q2NTJ1|Y1259_SODGM Probable transcriptional regulatory protein SG1259 OS=Sodalis glossinidius (strain morsitans) GN=SG1259 PE=3 SV=1 6 257 4.0E-24
sp|Q2JD97|Y1368_FRASC Probable transcriptional regulatory protein Francci3_1368 OS=Frankia sp. (strain CcI3) GN=Francci3_1368 PE=3 SV=1 6 248 4.0E-24
sp|A0Q6Q0|Y1028_FRATN Probable transcriptional regulatory protein FTN_1028 OS=Francisella tularensis subsp. novicida (strain U112) GN=FTN_1028 PE=3 SV=1 6 248 4.0E-24
sp|A8KZE9|Y5147_FRASN Probable transcriptional regulatory protein Franean1_5147 OS=Frankia sp. (strain EAN1pec) GN=Franean1_5147 PE=3 SV=1 6 248 4.0E-24
sp|Q3J055|Y2261_RHOS4 Probable transcriptional regulatory protein RHOS4_22610 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=RHOS4_22610 PE=3 SV=1 6 248 5.0E-24
sp|Q3AHR1|Y2132_SYNSC Probable transcriptional regulatory protein Syncc9605_2132 OS=Synechococcus sp. (strain CC9605) GN=Syncc9605_2132 PE=3 SV=2 6 249 6.0E-24
sp|B2V8P8|Y685_SULSY Probable transcriptional regulatory protein SYO3AOP1_0685 OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=SYO3AOP1_0685 PE=3 SV=1 6 248 6.0E-24
sp|A1R727|Y2300_ARTAT Probable transcriptional regulatory protein AAur_2300 OS=Arthrobacter aurescens (strain TC1) GN=AAur_2300 PE=3 SV=1 6 248 6.0E-24
sp|A1WZ62|Y2210_HALHL Probable transcriptional regulatory protein Hhal_2210 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=Hhal_2210 PE=3 SV=1 6 248 6.0E-24
sp|P62036|Y1074_GEOSL Probable transcriptional regulatory protein GSU1074 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=GSU1074 PE=3 SV=1 6 248 7.0E-24
sp|Q3AZG7|Y542_SYNS9 Probable transcriptional regulatory protein Syncc9902_0542 OS=Synechococcus sp. (strain CC9902) GN=Syncc9902_0542 PE=3 SV=1 6 249 7.0E-24
sp|B9LZC7|Y2326_GEODF Probable transcriptional regulatory protein Geob_2326 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=Geob_2326 PE=3 SV=1 6 248 7.0E-24
sp|A7NBV2|Y979_FRATF Probable transcriptional regulatory protein FTA_0979 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=FTA_0979 PE=3 SV=1 6 248 8.0E-24
sp|Q2A3R0|Y929_FRATH Probable transcriptional regulatory protein FTL_0929 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=FTL_0929 PE=3 SV=1 6 248 8.0E-24
sp|Q0BM66|Y908_FRATO Probable transcriptional regulatory protein FTH_0908 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=FTH_0908 PE=3 SV=1 6 248 8.0E-24
sp|A4X5V5|Y1792_SALTO Probable transcriptional regulatory protein Strop_1792 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=Strop_1792 PE=3 SV=1 6 248 8.0E-24
sp|Q5NH19|Y655_FRATT Probable transcriptional regulatory protein FTT_0655 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=FTT_0655 PE=3 SV=1 6 248 8.0E-24
sp|Q14IH1|Y655_FRAT1 Probable transcriptional regulatory protein FTF0655 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=FTF0655 PE=3 SV=1 6 248 8.0E-24
sp|A7HUZ5|Y2114_PARL1 Probable transcriptional regulatory protein Plav_2114 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=Plav_2114 PE=3 SV=1 6 248 9.0E-24
sp|P62039|Y1030_MYCPA Probable transcriptional regulatory protein MAP_1030 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_1030 PE=3 SV=1 6 248 1.0E-23
sp|B9KL75|Y2012_RHOSK Probable transcriptional regulatory protein RSKD131_2012 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=RSKD131_2012 PE=3 SV=1 6 248 1.0E-23
sp|A4IY88|Y1073_FRATW Probable transcriptional regulatory protein FTW_1073 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=FTW_1073 PE=3 SV=1 6 248 1.0E-23
sp|B3E787|Y1245_GEOLS Probable transcriptional regulatory protein Glov_1245 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=Glov_1245 PE=3 SV=1 6 248 1.0E-23
sp|Q4ZWL4|Y1407_PSEU2 Probable transcriptional regulatory protein Psyr_1407 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=Psyr_1407 PE=3 SV=1 6 248 1.0E-23
sp|B2KDV7|Y1151_ELUMP Probable transcriptional regulatory protein Emin_1151 OS=Elusimicrobium minutum (strain Pei191) GN=Emin_1151 PE=3 SV=1 6 248 1.0E-23
sp|Q3K7V7|Y4410_PSEPF Probable transcriptional regulatory protein Pfl01_4410 OS=Pseudomonas fluorescens (strain Pf0-1) GN=Pfl01_4410 PE=3 SV=1 6 248 2.0E-23
sp|B2SH70|Y1203_FRATM Probable transcriptional regulatory protein FTM_1203 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=FTM_1203 PE=3 SV=1 6 248 2.0E-23
sp|A4FBA3|Y2018_SACEN Probable transcriptional regulatory protein SACE_2018 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=SACE_2018 PE=3 SV=1 6 248 2.0E-23
sp|Q48FC2|Y3775_PSE14 Probable transcriptional regulatory protein PSPPH_3775 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=PSPPH_3775 PE=3 SV=1 6 248 2.0E-23
sp|B0TZD8|Y1570_FRAP2 Probable transcriptional regulatory protein Fphi_1565 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=Fphi_1565 PE=3 SV=1 6 249 2.0E-23
sp|B1MCJ6|Y2888_MYCA9 Probable transcriptional regulatory protein MAB_2888c OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=MAB_2888c PE=3 SV=1 6 249 3.0E-23
sp|A0JXB4|Y2304_ARTS2 Probable transcriptional regulatory protein Arth_2304 OS=Arthrobacter sp. (strain FB24) GN=Arth_2304 PE=3 SV=1 6 248 3.0E-23
sp|B7GR15|Y1155_BIFLS Probable transcriptional regulatory protein Blon_1155/BLIJ_1182 OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=Blon_1155 PE=3 SV=1 6 226 3.0E-23
sp|A5G9Y5|Y1416_GEOUR Probable transcriptional regulatory protein Gura_1416 OS=Geobacter uraniireducens (strain Rf4) GN=Gura_1416 PE=3 SV=1 6 248 4.0E-23
sp|A4SWH2|Y618_POLSQ Probable transcriptional regulatory protein Pnuc_0618 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=Pnuc_0618 PE=3 SV=1 6 248 4.0E-23
sp|Q87Y32|Y3980_PSESM Probable transcriptional regulatory protein PSPTO_3980 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=PSPTO_3980 PE=3 SV=1 6 248 4.0E-23
sp|Q4K7D6|Y4766_PSEF5 Probable transcriptional regulatory protein PFL_4766 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=PFL_4766 PE=3 SV=1 6 248 5.0E-23
sp|Q478D8|Y4067_DECAR Probable transcriptional regulatory protein Daro_4067 OS=Dechloromonas aromatica (strain RCB) GN=Daro_4067 PE=3 SV=1 6 232 5.0E-23
sp|B8H9D9|Y2034_ARTCA Probable transcriptional regulatory protein Achl_2034 OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=Achl_2034 PE=3 SV=1 6 248 6.0E-23
sp|A5EXG2|Y1179_DICNV Probable transcriptional regulatory protein DNO_1179 OS=Dichelobacter nodosus (strain VCS1703A) GN=DNO_1179 PE=3 SV=1 6 248 6.0E-23
sp|Q0AJA6|Y281_NITEC Probable transcriptional regulatory protein Neut_0281 OS=Nitrosomonas eutropha (strain C91) GN=Neut_0281 PE=3 SV=1 6 246 7.0E-23
sp|C5CCI4|Y1291_MICLC Probable transcriptional regulatory protein Mlut_12910 OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=Mlut_12910 PE=3 SV=1 6 249 7.0E-23
sp|A8LWZ6|Y1779_SALAI Probable transcriptional regulatory protein Sare_1779 OS=Salinispora arenicola (strain CNS-205) GN=Sare_1779 PE=3 SV=1 6 248 7.0E-23
sp|A1B3A6|Y1905_PARDP Probable transcriptional regulatory protein Pden_1905 OS=Paracoccus denitrificans (strain Pd 1222) GN=Pden_1905 PE=3 SV=1 6 248 7.0E-23
sp|Q0C5U8|Y161_HYPNA Probable transcriptional regulatory protein HNE_0161 OS=Hyphomonas neptunium (strain ATCC 15444) GN=HNE_0161 PE=3 SV=1 6 264 8.0E-23
sp|Q82XP6|Y210_NITEU Probable transcriptional regulatory protein NE0210 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=NE0210 PE=3 SV=1 6 246 9.0E-23
sp|A0LGY9|Y996_SYNFM Probable transcriptional regulatory protein Sfum_0996 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=Sfum_0996 PE=3 SV=1 6 248 1.0E-22
sp|Q8G6C0|Y726_BIFLO Probable transcriptional regulatory protein BL0726 OS=Bifidobacterium longum (strain NCC 2705) GN=BL0726 PE=3 SV=1 6 226 1.0E-22
sp|B3DRX7|Y450_BIFLD Probable transcriptional regulatory protein BLD_0450 OS=Bifidobacterium longum (strain DJO10A) GN=BLD_0450 PE=3 SV=1 6 226 1.0E-22
sp|Q2LRB1|Y739_SYNAS Probable transcriptional regulatory protein SYNAS_07390 OS=Syntrophus aciditrophicus (strain SB) GN=SYNAS_07390 PE=3 SV=1 6 248 1.0E-22
sp|P67192|Y504_TROW8 Probable transcriptional regulatory protein TW504 OS=Tropheryma whipplei (strain TW08/27) GN=TW504 PE=3 SV=1 6 249 2.0E-22
sp|P67191|Y266_TROWT Probable transcriptional regulatory protein TWT_266 OS=Tropheryma whipplei (strain Twist) GN=TWT_266 PE=3 SV=1 6 249 2.0E-22
sp|B0SJP0|Y056_LEPBP Probable transcriptional regulatory protein LEPBI_I0056 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=LEPBI_I0056 PE=3 SV=1 6 252 2.0E-22
sp|B0S959|Y056_LEPBA Probable transcriptional regulatory protein LBF_0056 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=LBF_0056 PE=3 SV=1 6 252 2.0E-22
sp|B1VDJ5|Y933_CORU7 Probable transcriptional regulatory protein cu0933 OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=cu0933 PE=3 SV=1 6 249 2.0E-22
sp|A0L4W1|Y479_MAGMM Probable transcriptional regulatory protein Mmc1_0479 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=Mmc1_0479 PE=3 SV=1 6 248 3.0E-22
sp|Q0S1C9|Y6891_RHOJR Probable transcriptional regulatory protein RHA1_ro06891 OS=Rhodococcus jostii (strain RHA1) GN=RHA1_ro06891 PE=3 SV=2 6 249 3.0E-22
sp|B0BQ92|Y1171_ACTPJ Probable transcriptional regulatory protein APJL_1171 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=APJL_1171 PE=3 SV=1 6 257 3.0E-22
sp|A5CS09|Y1817_CLAM3 Probable transcriptional regulatory protein CMM_1817 OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=CMM_1817 PE=3 SV=1 6 248 3.0E-22
sp|Q02IC6|Y5181_PSEAB Probable transcriptional regulatory protein PA14_51810 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=PA14_51810 PE=3 SV=1 6 248 4.0E-22
sp|B7UXW8|Y4350_PSEA8 Probable transcriptional regulatory protein PLES_43501 OS=Pseudomonas aeruginosa (strain LESB58) GN=PLES_43501 PE=3 SV=1 6 248 4.0E-22
sp|Q51423|PMPR_PSEAE Transcriptional regulatory protein PmpR OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pmpR PE=1 SV=2 6 248 4.0E-22
sp|B0CDE2|Y1847_ACAM1 Probable transcriptional regulatory protein AM1_1847 OS=Acaryochloris marina (strain MBIC 11017) GN=AM1_1847 PE=3 SV=1 6 249 4.0E-22
sp|Q7V5W3|Y1423_PROMM Probable transcriptional regulatory protein PMT_1423 OS=Prochlorococcus marinus (strain MIT 9313) GN=PMT_1423 PE=3 SV=1 6 249 4.0E-22
sp|B3GY39|Y1210_ACTP7 Probable transcriptional regulatory protein APP7_1210 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=APP7_1210 PE=3 SV=1 6 257 4.0E-22
sp|A3N1F5|Y1151_ACTP2 Probable transcriptional regulatory protein APL_1151 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=APL_1151 PE=3 SV=1 6 257 4.0E-22
sp|A4G2N0|Y561_HERAR Probable transcriptional regulatory protein HEAR0561 OS=Herminiimonas arsenicoxydans GN=HEAR0561 PE=3 SV=1 6 248 6.0E-22
sp|P62042|Y1487_TREDE Probable transcriptional regulatory protein TDE_1487 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=TDE_1487 PE=3 SV=1 6 250 7.0E-22
sp|Q49645|Y475_MYCLE Probable transcriptional regulatory protein ML0475 OS=Mycobacterium leprae (strain TN) GN=ML0475 PE=3 SV=1 6 248 8.0E-22
sp|B8ZUH9|Y475_MYCLB Probable transcriptional regulatory protein MLBr00475 OS=Mycobacterium leprae (strain Br4923) GN=MLBr00475 PE=3 SV=1 6 248 8.0E-22
sp|A6VA08|Y4544_PSEA7 Probable transcriptional regulatory protein PSPA7_4544 OS=Pseudomonas aeruginosa (strain PA7) GN=PSPA7_4544 PE=3 SV=1 6 248 1.0E-21
sp|A4SPN4|Y2843_AERS4 Probable transcriptional regulatory protein ASA_2843 OS=Aeromonas salmonicida (strain A449) GN=ASA_2843 PE=3 SV=1 6 257 1.0E-21
sp|Q20X07|Y4807_RHOPB Probable transcriptional regulatory protein RPC_4807 OS=Rhodopseudomonas palustris (strain BisB18) GN=RPC_4807 PE=3 SV=1 6 264 1.0E-21
sp|Q1QHP3|Y3525_NITHX Probable transcriptional regulatory protein Nham_3525 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=Nham_3525 PE=3 SV=1 6 264 1.0E-21
sp|B3E045|Y651_METI4 Probable transcriptional regulatory protein Minf_0651 OS=Methylacidiphilum infernorum (isolate V4) GN=Minf_0651 PE=3 SV=1 6 248 1.0E-21
sp|Q5YTE1|Y3702_NOCFA Probable transcriptional regulatory protein NFA_37020 OS=Nocardia farcinica (strain IFM 10152) GN=NFA_37020 PE=3 SV=1 6 249 1.0E-21
sp|P53212|YG1D_YEAST Probable transcriptional regulatory protein HAH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR021W PE=1 SV=1 7 248 1.0E-21
sp|A6SVD7|Y544_JANMA Probable transcriptional regulatory protein mma_0544 OS=Janthinobacterium sp. (strain Marseille) GN=mma_0544 PE=3 SV=1 6 248 1.0E-21
sp|C1B4C8|Y6870_RHOOB Probable transcriptional regulatory protein ROP_68700 OS=Rhodococcus opacus (strain B4) GN=ROP_68700 PE=3 SV=1 6 249 1.0E-21
sp|B0REB7|Y715_CLAMS Probable transcriptional regulatory protein CMS0715 OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=CMS0715 PE=3 SV=1 6 248 2.0E-21
sp|A1K2Y6|Y574_AZOSB Probable transcriptional regulatory protein azo0574 OS=Azoarcus sp. (strain BH72) GN=azo0574 PE=3 SV=1 6 242 3.0E-21
sp|Q3SP09|Y2729_NITWN Probable transcriptional regulatory protein Nwi_2729 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=Nwi_2729 PE=3 SV=1 6 264 3.0E-21
sp|Q3SGS9|Y2215_THIDA Probable transcriptional regulatory protein Tbd_2215 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=Tbd_2215 PE=3 SV=1 6 248 3.0E-21
sp|B8F5G8|Y943_HAEPS Probable transcriptional regulatory protein HAPS_0943 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=HAPS_0943 PE=3 SV=1 6 257 3.0E-21
sp|Q4JVD6|Y1057_CORJK Probable transcriptional regulatory protein jk1057 OS=Corynebacterium jeikeium (strain K411) GN=jk1057 PE=3 SV=1 6 174 3.0E-21
sp|Q9CM61|Y980_PASMU Probable transcriptional regulatory protein PM0980 OS=Pasteurella multocida (strain Pm70) GN=PM0980 PE=3 SV=1 6 257 3.0E-21
sp|B2GIM1|Y1367_KOCRD Probable transcriptional regulatory protein KRH_13670 OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=KRH_13670 PE=3 SV=1 6 248 4.0E-21
sp|C0QGP3|Y400_DESAH Probable transcriptional regulatory protein HRM2_04000 OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=HRM2_04000 PE=3 SV=1 6 232 4.0E-21
sp|A9WSE7|Y2002_RENSM Probable transcriptional regulatory protein RSal33209_2002 OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=RSal33209_2002 PE=3 SV=1 6 267 4.0E-21
sp|Q8RIE0|Y1661_FUSNN Probable transcriptional regulatory protein FN1661 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=FN1661 PE=3 SV=1 6 249 5.0E-21
sp|C0ZZ45|Y2922_RHOE4 Probable transcriptional regulatory protein RER_29220 OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=RER_29220 PE=3 SV=1 6 249 6.0E-21
sp|B8GUJ7|Y2237_THISH Probable transcriptional regulatory protein Tgr7_2237 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=Tgr7_2237 PE=3 SV=1 6 185 6.0E-21
sp|B4ETP5|Y1113_PROMH Probable transcriptional regulatory protein PMI1113 OS=Proteus mirabilis (strain HI4320) GN=PMI1113 PE=3 SV=1 6 248 6.0E-21
sp|Q3MDT4|Y1228_ANAVT Probable transcriptional regulatory protein Ava_1228 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=Ava_1228 PE=3 SV=1 6 248 6.0E-21
sp|B1ZSR1|Y1471_OPITP Probable transcriptional regulatory protein Oter_1471 OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=Oter_1471 PE=3 SV=1 6 248 7.0E-21
sp|Q1GYR5|Y2355_METFK Probable transcriptional regulatory protein Mfla_2355 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=Mfla_2355 PE=3 SV=1 6 219 9.0E-21
sp|Q0I7Z0|Y2234_SYNS3 Probable transcriptional regulatory protein sync_2234 OS=Synechococcus sp. (strain CC9311) GN=sync_2234 PE=3 SV=1 6 232 1.0E-20
sp|A1SJA3|Y2383_NOCSJ Probable transcriptional regulatory protein Noca_2383 OS=Nocardioides sp. (strain BAA-499 / JS614) GN=Noca_2383 PE=3 SV=1 6 248 1.0E-20
sp|A8F5Z3|Y1011_PSELT Probable transcriptional regulatory protein Tlet_1011 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=Tlet_1011 PE=3 SV=1 6 248 1.0E-20
sp|A0KIF9|Y1522_AERHH Probable transcriptional regulatory protein AHA_1522 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=AHA_1522 PE=3 SV=1 6 257 1.0E-20
sp|Q1GWB2|Y337_SPHAL Probable transcriptional regulatory protein Sala_0337 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=Sala_0337 PE=3 SV=1 6 248 1.0E-20
sp|Q7N550|Y2109_PHOLL Probable transcriptional regulatory protein plu2109 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=plu2109 PE=3 SV=1 6 257 1.0E-20
sp|B7K8I7|Y2775_CYAP7 Probable transcriptional regulatory protein PCC7424_2775 OS=Cyanothece sp. (strain PCC 7424) GN=PCC7424_2775 PE=3 SV=1 6 248 1.0E-20
sp|Q0BT57|Y1097_GRABC Probable transcriptional regulatory protein GbCGDNIH1_1097 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=GbCGDNIH1_1097 PE=3 SV=1 6 248 1.0E-20
sp|Q7VNF3|Y596_HAEDU Probable transcriptional regulatory protein HD_0596 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=HD_0596 PE=3 SV=1 6 257 1.0E-20
sp|Q8YPC2|Y4276_NOSS1 Probable transcriptional regulatory protein all4276 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all4276 PE=3 SV=1 6 248 2.0E-20
sp|Q1AWE6|Y1318_RUBXD Probable transcriptional regulatory protein Rxyl_1318 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=Rxyl_1318 PE=3 SV=1 6 248 2.0E-20
sp|B8FL13|Y2958_DESAA Probable transcriptional regulatory protein Dalk_2958 OS=Desulfatibacillum alkenivorans (strain AK-01) GN=Dalk_2958 PE=3 SV=1 6 257 2.0E-20
sp|Q130U9|Y4171_RHOPS Probable transcriptional regulatory protein RPD_4171 OS=Rhodopseudomonas palustris (strain BisB5) GN=RPD_4171 PE=3 SV=1 6 264 2.0E-20
sp|Q3JES6|Y137_NITOC Probable transcriptional regulatory protein Noc_0137 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=Noc_0137 PE=3 SV=1 6 248 2.0E-20
sp|A5UGD1|Y4390_HAEIG Probable transcriptional regulatory protein CGSHiGG_04390 OS=Haemophilus influenzae (strain PittGG) GN=CGSHiGG_04390 PE=3 SV=1 6 257 2.0E-20
sp|Q4QNM3|Y433_HAEI8 Probable transcriptional regulatory protein NTHI0433 OS=Haemophilus influenzae (strain 86-028NP) GN=NTHI0433 PE=3 SV=1 6 257 2.0E-20
sp|P44634|Y315_HAEIN Probable transcriptional regulatory protein HI_0315 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0315 PE=1 SV=1 6 257 2.0E-20
sp|A5UAH5|Y1480_HAEIE Probable transcriptional regulatory protein CGSHiEE_01480 OS=Haemophilus influenzae (strain PittEE) GN=CGSHiEE_01480 PE=3 SV=1 6 257 2.0E-20
sp|C1DAZ0|Y2347_LARHH Probable transcriptional regulatory protein LHK_02347 OS=Laribacter hongkongensis (strain HLHK9) GN=LHK_02347 PE=3 SV=1 6 198 2.0E-20
sp|B3CTY9|Y1378_ORITI Probable transcriptional regulatory protein OTT_1378 OS=Orientia tsutsugamushi (strain Ikeda) GN=OTT_1378 PE=3 SV=1 6 248 2.0E-20
sp|C4LBN3|Y2714_TOLAT Probable transcriptional regulatory protein Tola_2714 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=Tola_2714 PE=3 SV=1 6 257 2.0E-20
sp|Q2IS49|Y4273_RHOP2 Probable transcriptional regulatory protein RPB_4273 OS=Rhodopseudomonas palustris (strain HaA2) GN=RPB_4273 PE=3 SV=1 6 264 2.0E-20
sp|Q5QYV3|Y1088_IDILO Probable transcriptional regulatory protein IL1088 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=IL1088 PE=3 SV=1 6 248 3.0E-20
sp|C4LIY0|Y1032_CORK4 Probable transcriptional regulatory protein ckrop_1032 OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=ckrop_1032 PE=3 SV=1 6 249 3.0E-20
sp|A6VQA7|Y1803_ACTSZ Probable transcriptional regulatory protein Asuc_1803 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=Asuc_1803 PE=3 SV=1 6 257 3.0E-20
sp|B8I4L5|Y181_CLOCE Probable transcriptional regulatory protein Ccel_0181 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=Ccel_0181 PE=3 SV=1 6 246 3.0E-20
sp|A3DH53|Y2075_CLOTH Probable transcriptional regulatory protein Cthe_2075 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=Cthe_2075 PE=3 SV=1 6 248 3.0E-20
sp|Q28LW5|Y3380_JANSC Probable transcriptional regulatory protein Jann_3380 OS=Jannaschia sp. (strain CCS1) GN=Jann_3380 PE=3 SV=1 6 248 4.0E-20
sp|Q0ALW8|Y2433_MARMM Probable transcriptional regulatory protein Mmar10_2433 OS=Maricaulis maris (strain MCS10) GN=Mmar10_2433 PE=3 SV=1 6 248 4.0E-20
sp|A5CCC2|Y251_ORITB Probable transcriptional regulatory protein OTBS_0251 OS=Orientia tsutsugamushi (strain Boryong) GN=OTBS_0251 PE=3 SV=1 6 248 4.0E-20
sp|B5EJL6|Y060_ACIF5 Probable transcriptional regulatory protein Lferr_0060 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=Lferr_0060 PE=3 SV=1 6 248 5.0E-20
sp|B7J3G0|Y059_ACIF2 Probable transcriptional regulatory protein AFE_0059 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=AFE_0059 PE=3 SV=1 6 248 5.0E-20
sp|B0TF65|Y1757_HELMI Probable transcriptional regulatory protein Helmi_17570 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=Helmi_17570 PE=3 SV=1 6 248 6.0E-20
sp|Q0I244|Y508_HAES1 Probable transcriptional regulatory protein HS_0508 OS=Haemophilus somnus (strain 129Pt) GN=HS_0508 PE=3 SV=1 6 257 6.0E-20
sp|B8CXG6|Y1235_HALOH Probable transcriptional regulatory protein Hore_12350 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=Hore_12350 PE=3 SV=1 6 248 6.0E-20
sp|B2UQ11|Y709_AKKM8 Probable transcriptional regulatory protein Amuc_0709 OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=Amuc_0709 PE=3 SV=1 6 248 6.0E-20
sp|Q7U8R9|Y543_SYNPX Probable transcriptional regulatory protein SYNW0543 OS=Synechococcus sp. (strain WH8102) GN=SYNW0543 PE=3 SV=1 6 211 7.0E-20
sp|Q1IPS4|Y2125_KORVE Probable transcriptional regulatory protein Acid345_2125 OS=Koribacter versatilis (strain Ellin345) GN=Acid345_2125 PE=3 SV=1 6 249 7.0E-20
sp|Q5ZW02|Y1286_LEGPH Probable transcriptional regulatory protein lpg1286 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=lpg1286 PE=3 SV=1 6 248 7.0E-20
sp|B6INM1|Y1808_RHOCS Probable transcriptional regulatory protein RC1_1808 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=RC1_1808 PE=3 SV=1 6 248 8.0E-20
sp|B1H0B3|Y462_UNCTG Probable transcriptional regulatory protein TGRD_462 OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=TGRD_462 PE=3 SV=1 6 248 8.0E-20
sp|A4J533|Y1658_DESRM Probable transcriptional regulatory protein Dred_1658 OS=Desulfotomaculum reducens (strain MI-1) GN=Dred_1658 PE=3 SV=1 6 251 8.0E-20
sp|B0UVY2|Y1763_HISS2 Probable transcriptional regulatory protein HSM_1763 OS=Histophilus somni (strain 2336) GN=HSM_1763 PE=3 SV=1 6 257 9.0E-20
sp|Q07H94|Y4771_RHOP5 Probable transcriptional regulatory protein RPE_4771 OS=Rhodopseudomonas palustris (strain BisA53) GN=RPE_4771 PE=3 SV=1 6 248 1.0E-19
sp|Q5P3B7|Y2072_AROAE Probable transcriptional regulatory protein AZOSEA20720 OS=Aromatoleum aromaticum (strain EbN1) GN=AZOSEA20720 PE=3 SV=1 6 246 1.0E-19
sp|Q65UP3|Y710_MANSM Probable transcriptional regulatory protein MS0710 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=MS0710 PE=3 SV=1 6 257 1.0E-19
sp|Q8RAR7|Y1135_CALS4 Probable transcriptional regulatory protein TTE1135 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE1135 PE=3 SV=2 6 249 1.0E-19
sp|A9ITM2|Y3099_BORPD Probable transcriptional regulatory protein Bpet3099 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=Bpet3099 PE=3 SV=1 6 232 1.0E-19
sp|C1A617|Y635_GEMAT Probable transcriptional regulatory protein GAU_0635 OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=GAU_0635 PE=3 SV=1 6 227 1.0E-19
sp|A1TS27|Y3203_ACIAC Probable transcriptional regulatory protein Aave_3203 OS=Acidovorax citrulli (strain AAC00-1) GN=Aave_3203 PE=3 SV=1 6 248 1.0E-19
sp|B5Y8Y9|Y905_COPPD Probable transcriptional regulatory protein COPRO5265_0905 OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=COPRO5265_0905 PE=3 SV=1 6 248 1.0E-19
sp|Q8FPK2|Y1776_COREF Probable transcriptional regulatory protein CE1776 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=CE1776 PE=3 SV=2 6 249 1.0E-19
sp|B7GFM4|Y709_ANOFW Probable transcriptional regulatory protein Aflv_0709 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=Aflv_0709 PE=3 SV=1 6 249 2.0E-19
sp|Q6A8L0|Y1157_PROAC Probable transcriptional regulatory protein PPA1157 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=PPA1157 PE=3 SV=1 6 249 2.0E-19
sp|B2T2A5|Y1301_BURPP Probable transcriptional regulatory protein Bphyt_1301 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=Bphyt_1301 PE=3 SV=1 6 257 2.0E-19
sp|B4RMZ8|Y1508_NEIG2 Probable transcriptional regulatory protein NGK_1508 OS=Neisseria gonorrhoeae (strain NCCP11945) GN=NGK_1508 PE=3 SV=1 6 232 2.0E-19
sp|A5D3F8|Y1024_PELTS Probable transcriptional regulatory protein PTH_1024 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=PTH_1024 PE=3 SV=1 6 248 2.0E-19
sp|Q9JYC7|Y1648_NEIMB Probable transcriptional regulatory protein NMB1648 OS=Neisseria meningitidis serogroup B (strain MC58) GN=NMB1648 PE=3 SV=1 6 232 2.0E-19
sp|Q8NPZ8|Y1663_CORGL Probable transcriptional regulatory protein Cgl1663/cg1872 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=Cgl1663 PE=3 SV=1 6 249 2.0E-19
sp|Q5F792|Y1291_NEIG1 Probable transcriptional regulatory protein NGO1291 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=NGO1291 PE=3 SV=1 6 232 2.0E-19
sp|A7MEB8|Y1378_CROS8 Probable transcriptional regulatory protein ESA_01378 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ESA_01378 PE=3 SV=1 6 257 2.0E-19
sp|B2J7Y8|Y5651_NOSP7 Probable transcriptional regulatory protein Npun_R5651 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=Npun_R5651 PE=3 SV=1 6 248 2.0E-19
sp|A2C730|Y538_PROM3 Probable transcriptional regulatory protein P9303_05381 OS=Prochlorococcus marinus (strain MIT 9303) GN=P9303_05381 PE=3 SV=1 6 156 2.0E-19
sp|Q8EPQ4|Y2038_OCEIH Probable transcriptional regulatory protein OB2038 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=OB2038 PE=3 SV=1 6 251 2.0E-19
sp|Q168H2|Y2018_ROSDO Probable transcriptional regulatory protein RD1_2018 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=RD1_2018 PE=3 SV=1 6 248 2.0E-19
sp|Q7NTD5|Y3123_CHRVO Probable transcriptional regulatory protein CV_3123 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=CV_3123 PE=3 SV=1 6 198 2.0E-19
sp|C5B9S9|Y1596_EDWI9 Probable transcriptional regulatory protein NT01EI_1596 OS=Edwardsiella ictaluri (strain 93-146) GN=NT01EI_1596 PE=3 SV=1 6 248 2.0E-19
sp|Q88NJ3|Y1214_PSEPK Probable transcriptional regulatory protein PP_1214 OS=Pseudomonas putida (strain KT2440) GN=PP_1214 PE=3 SV=1 6 250 3.0E-19
sp|B7JYY6|Y2028_CYAP8 Probable transcriptional regulatory protein PCC8801_2028 OS=Cyanothece sp. (strain PCC 8801) GN=PCC8801_2028 PE=3 SV=1 6 248 3.0E-19
sp|Q12C45|Y1967_POLSJ Probable transcriptional regulatory protein Bpro_1967 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=Bpro_1967 PE=3 SV=1 6 195 3.0E-19
sp|A4QEN6|Y1708_CORGB Probable transcriptional regulatory protein cgR_1708 OS=Corynebacterium glutamicum (strain R) GN=cgR_1708 PE=3 SV=1 6 249 3.0E-19
sp|Q5X5S1|Y1249_LEGPA Probable transcriptional regulatory protein lpp1249 OS=Legionella pneumophila (strain Paris) GN=lpp1249 PE=3 SV=1 6 248 3.0E-19
sp|Q0KD59|Y916_CUPNH Probable transcriptional regulatory protein H16_A0916 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=H16_A0916 PE=3 SV=1 6 248 3.0E-19
sp|A8LJ00|Y2762_DINSH Probable transcriptional regulatory protein Dshi_2762 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=Dshi_2762 PE=3 SV=1 6 226 3.0E-19
sp|A5IBD9|Y711_LEGPC Probable transcriptional regulatory protein LPC_0711 OS=Legionella pneumophila (strain Corby) GN=LPC_0711 PE=3 SV=1 6 248 3.0E-19
sp|B1YU49|Y2210_BURA4 Probable transcriptional regulatory protein BamMC406_2210 OS=Burkholderia ambifaria (strain MC40-6) GN=BamMC406_2210 PE=3 SV=1 6 248 3.0E-19
sp|Q609L3|Y1220_METCA Probable transcriptional regulatory protein MCA1220 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=MCA1220 PE=3 SV=1 6 248 3.0E-19
sp|Q38W22|Y1307_LACSS Probable transcriptional regulatory protein LCA_1307 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=LCA_1307 PE=3 SV=1 6 246 4.0E-19
sp|Q39EA1|Y5621_BURL3 Probable transcriptional regulatory protein Bcep18194_A5621 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=Bcep18194_A5621 PE=3 SV=1 6 248 4.0E-19
sp|Q03EU1|Y1240_PEDPA Probable transcriptional regulatory protein PEPE_1240 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=PEPE_1240 PE=3 SV=1 6 246 4.0E-19
sp|B4E5R6|Y2348_BURCJ Probable transcriptional regulatory protein BceJ2315_23480 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=BceJ2315_23480 PE=3 SV=1 6 248 4.0E-19
sp|B1JW41|Y2317_BURCC Probable transcriptional regulatory protein Bcenmc03_2317 OS=Burkholderia cenocepacia (strain MC0-3) GN=Bcenmc03_2317 PE=3 SV=1 6 248 4.0E-19
sp|A0K968|Y2294_BURCH Probable transcriptional regulatory protein Bcen2424_2294 OS=Burkholderia cenocepacia (strain HI2424) GN=Bcen2424_2294 PE=3 SV=1 6 248 4.0E-19
sp|Q1BUW9|Y1682_BURCA Probable transcriptional regulatory protein Bcen_1682 OS=Burkholderia cenocepacia (strain AU 1054) GN=Bcen_1682 PE=3 SV=1 6 248 4.0E-19
sp|B5YHS2|Y1868_THEYD Probable transcriptional regulatory protein THEYE_A1868 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=THEYE_A1868 PE=3 SV=1 6 248 4.0E-19
sp|C5D5F1|Y2524_GEOSW Probable transcriptional regulatory protein GWCH70_2524 OS=Geobacillus sp. (strain WCH70) GN=GWCH70_2524 PE=3 SV=1 6 256 4.0E-19
sp|A4SG34|Y1432_CHLPM Probable transcriptional regulatory protein Cvib_1432 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=Cvib_1432 PE=3 SV=1 6 254 4.0E-19
sp|Q042I3|Y1276_LACGA Probable transcriptional regulatory protein LGAS_1276 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=LGAS_1276 PE=3 SV=1 6 257 5.0E-19
sp|B8IN22|Y7401_METNO Probable transcriptional regulatory protein Mnod_7401 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=Mnod_7401 PE=3 SV=1 6 262 5.0E-19
sp|A5GN83|Y1972_SYNPW Probable transcriptional regulatory protein SynWH7803_1972 OS=Synechococcus sp. (strain WH7803) GN=SynWH7803_1972 PE=3 SV=1 6 143 5.0E-19
sp|Q5LUI2|Y1072_RUEPO Probable transcriptional regulatory protein SPO1072 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=SPO1072 PE=3 SV=1 6 248 5.0E-19
sp|Q9JTB0|Y1902_NEIMA Probable transcriptional regulatory protein NMA1902 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=NMA1902 PE=3 SV=1 6 232 5.0E-19
sp|A1KV56|Y1563_NEIMF Probable transcriptional regulatory protein NMC1563 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=NMC1563 PE=3 SV=1 6 232 5.0E-19
sp|A1QYH8|Y025_BORT9 Probable transcriptional regulatory protein BT0025 OS=Borrelia turicatae (strain 91E135) GN=BT0025 PE=3 SV=1 6 171 5.0E-19
sp|Q6AFB7|Y1075_LEIXX Probable transcriptional regulatory protein Lxx10750 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=Lxx10750 PE=3 SV=1 6 189 6.0E-19
sp|P62034|Y1378_CORDI Probable transcriptional regulatory protein DIP1378 OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=DIP1378 PE=3 SV=1 6 249 7.0E-19
sp|B9MQH7|Y816_CALBD Probable transcriptional regulatory protein Athe_0816 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=Athe_0816 PE=3 SV=1 6 248 7.0E-19
sp|B7J0W4|Y025_BORBZ Probable transcriptional regulatory protein BbuZS7_0025 OS=Borrelia burgdorferi (strain ZS7) GN=BbuZS7_0025 PE=3 SV=1 6 249 8.0E-19
sp|O51056|Y025_BORBU Probable transcriptional regulatory protein BB_0025 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=BB_0025 PE=3 SV=1 6 249 8.0E-19
sp|B3EMM7|Y542_CHLPB Probable transcriptional regulatory protein Cphamn1_0542 OS=Chlorobium phaeobacteroides (strain BS1) GN=Cphamn1_0542 PE=3 SV=1 6 249 8.0E-19
sp|B3QLZ4|Y525_CHLP8 Probable transcriptional regulatory protein Cpar_0525 OS=Chlorobaculum parvum (strain NCIB 8327) GN=Cpar_0525 PE=3 SV=1 6 249 9.0E-19
sp|C3PGR0|Y1421_CORA7 Probable transcriptional regulatory protein cauri_1421 OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=cauri_1421 PE=3 SV=1 6 144 1.0E-18
sp|Q0SPD9|Y024_BORAP Probable transcriptional regulatory protein BAPKO_0024/BafPKo_0025 OS=Borrelia afzelii (strain PKo) GN=BAPKO_0024 PE=3 SV=1 6 249 1.0E-18
sp|Q0BD85|Y2332_BURCM Probable transcriptional regulatory protein Bamb_2332 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=Bamb_2332 PE=3 SV=1 6 248 1.0E-18
sp|B0UD14|Y6579_METS4 Probable transcriptional regulatory protein M446_6579 OS=Methylobacterium sp. (strain 4-46) GN=M446_6579 PE=3 SV=1 6 248 1.0E-18
sp|A8GFJ0|Y2779_SERP5 Probable transcriptional regulatory protein Spro_2779 OS=Serratia proteamaculans (strain 568) GN=Spro_2779 PE=3 SV=1 6 257 1.0E-18
sp|Q2KYW0|Y2207_BORA1 Probable transcriptional regulatory protein BAV2207 OS=Bordetella avium (strain 197N) GN=BAV2207 PE=3 SV=1 6 249 1.0E-18
sp|B2JE34|Y2064_BURP8 Probable transcriptional regulatory protein Bphy_2064 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=Bphy_2064 PE=3 SV=1 6 257 1.0E-18
sp|Q8XXC5|Y2190_RALSO Probable transcriptional regulatory protein RSc2190 OS=Ralstonia solanacearum (strain GMI1000) GN=RSc2190 PE=3 SV=1 6 248 1.0E-18
sp|Q8DME3|Y175_THEEB Probable transcriptional regulatory protein tll0175 OS=Thermosynechococcus elongatus (strain BP-1) GN=tll0175 PE=3 SV=1 6 249 1.0E-18
sp|C6DFE9|Y1817_PECCP Probable transcriptional regulatory protein PC1_1817 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=PC1_1817 PE=3 SV=1 6 257 1.0E-18
sp|A4WBM1|Y2432_ENT38 Probable transcriptional regulatory protein Ent638_2432 OS=Enterobacter sp. (strain 638) GN=Ent638_2432 PE=3 SV=1 6 248 2.0E-18
sp|C1F121|Y521_ACIC5 Probable transcriptional regulatory protein ACP_0521 OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=ACP_0521 PE=3 SV=1 6 248 2.0E-18
sp|P62037|Y904_LACJO Probable transcriptional regulatory protein LJ_0904 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=LJ_0904 PE=3 SV=1 6 257 2.0E-18
sp|Q5FQC7|Y1679_GLUOX Probable transcriptional regulatory protein GOX1679 OS=Gluconobacter oxydans (strain 621H) GN=GOX1679 PE=3 SV=1 6 248 2.0E-18
sp|Q142L6|Y1185_BURXL Probable transcriptional regulatory protein Bxeno_A1185 OS=Burkholderia xenovorans (strain LB400) GN=Bxeno_A1185 PE=3 SV=1 6 248 2.0E-18
sp|Q9ZNK0|YU82_CLOHI Probable transcriptional regulatory protein ORF2U OS=Clostridium histolyticum PE=3 SV=1 6 259 2.0E-18
sp|A9MND4|YEBC_SALAR Probable transcriptional regulatory protein YebC OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=yebC PE=3 SV=1 6 257 2.0E-18
sp|Q5WX49|Y1249_LEGPL Probable transcriptional regulatory protein lpl1249 OS=Legionella pneumophila (strain Lens) GN=lpl1249 PE=3 SV=1 6 248 2.0E-18
sp|Q5N4Q0|Y529_SYNP6 Probable transcriptional regulatory protein syc0529_d OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=syc0529_d PE=3 SV=1 6 249 2.0E-18
sp|Q89U83|Y1534_BRADU Probable transcriptional regulatory protein blr1534 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=blr1534 PE=3 SV=1 6 248 2.0E-18
sp|Q7VWE9|Y2308_BORPE Probable transcriptional regulatory protein BP2308 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=BP2308 PE=3 SV=1 6 249 2.0E-18
sp|Q1D2J3|Y4974_MYXXD Probable transcriptional regulatory protein MXAN_4974 OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_4974 PE=3 SV=1 6 248 2.0E-18
sp|A4JGH5|Y2379_BURVG Probable transcriptional regulatory protein Bcep1808_2379 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=Bcep1808_2379 PE=3 SV=1 6 248 2.0E-18
sp|Q4A9L4|Y471_MYCHJ Probable transcriptional regulatory protein MHJ_0471 OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=MHJ_0471 PE=3 SV=1 6 250 2.0E-18
sp|A5GV27|Y1833_SYNR3 Probable transcriptional regulatory protein SynRCC307_1833 OS=Synechococcus sp. (strain RCC307) GN=SynRCC307_1833 PE=3 SV=1 6 212 3.0E-18
sp|A7FY22|Y3102_CLOB1 Probable transcriptional regulatory protein CLB_3102 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=CLB_3102 PE=3 SV=1 6 218 3.0E-18
sp|A5I6F4|Y3073_CLOBH Probable transcriptional regulatory protein CBO3073/CLC_2975 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=CBO3073 PE=3 SV=1 6 218 3.0E-18
sp|C1FKG4|Y3478_CLOBJ Probable transcriptional regulatory protein CLM_3478 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=CLM_3478 PE=3 SV=1 6 221 3.0E-18
sp|Q322D6|YEBC_SHIBS Probable transcriptional regulatory protein YebC OS=Shigella boydii serotype 4 (strain Sb227) GN=yebC PE=3 SV=1 6 184 3.0E-18
sp|A8AFH7|Y1097_CITK8 Probable transcriptional regulatory protein CKO_01097 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=CKO_01097 PE=3 SV=1 6 257 3.0E-18
sp|Q9RGC3|Y472_MYCH2 Probable transcriptional regulatory protein mhp472 OS=Mycoplasma hyopneumoniae (strain 232) GN=mhp472 PE=3 SV=2 6 250 3.0E-18
sp|Q6FAP5|Y2052_ACIAD Probable transcriptional regulatory protein ACIAD2052 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ACIAD2052 PE=3 SV=1 6 249 3.0E-18
sp|Q7URR4|Y5500_RHOBA Probable transcriptional regulatory protein RB5500 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=RB5500 PE=3 SV=1 6 248 4.0E-18
sp|Q4A7P8|Y474_MYCH7 Probable transcriptional regulatory protein MHP7448_0474 OS=Mycoplasma hyopneumoniae (strain 7448) GN=MHP7448_0474 PE=3 SV=1 6 250 4.0E-18
sp|C4K4U6|Y869_HAMD5 Probable transcriptional regulatory protein HDEF_0869 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=HDEF_0869 PE=3 SV=1 6 248 4.0E-18
sp|C3KTD5|Y3338_CLOB6 Probable transcriptional regulatory protein CLJ_B3338 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=CLJ_B3338 PE=3 SV=1 6 221 4.0E-18
sp|A7GHU1|Y3132_CLOBL Probable transcriptional regulatory protein CLI_3132 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=CLI_3132 PE=3 SV=1 6 221 4.0E-18
sp|B0K0L3|Y1449_THEPX Probable transcriptional regulatory protein Teth514_1449 OS=Thermoanaerobacter sp. (strain X514) GN=Teth514_1449 PE=3 SV=1 6 250 4.0E-18
sp|B0K951|Y1009_THEP3 Probable transcriptional regulatory protein Teth39_1009 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=Teth39_1009 PE=3 SV=1 6 250 4.0E-18
sp|A2S4B3|Y3092_BURM9 Probable transcriptional regulatory protein BMA10229_A0792 OS=Burkholderia mallei (strain NCTC 10229) GN=BMA10229_A0792 PE=3 SV=1 6 248 4.0E-18
sp|A1V2G2|Y2875_BURMS Probable transcriptional regulatory protein BMASAVP1_A1075 OS=Burkholderia mallei (strain SAVP1) GN=BMASAVP1_A1075 PE=3 SV=1 6 248 4.0E-18
sp|A3MI47|Y2858_BURM7 Probable transcriptional regulatory protein BMA10247_0358 OS=Burkholderia mallei (strain NCTC 10247) GN=BMA10247_0358 PE=3 SV=1 6 248 4.0E-18
sp|A9AJK0|Y2280_BURM1 Probable transcriptional regulatory protein Bmul_0984/BMULJ_02280 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=Bmul_0984 PE=3 SV=1 6 248 4.0E-18
sp|Q62IJ0|Y1884_BURMA Probable transcriptional regulatory protein BMA1884 OS=Burkholderia mallei (strain ATCC 23344) GN=BMA1884 PE=3 SV=1 6 248 4.0E-18
sp|Q3JUF8|Y1385_BURP1 Probable transcriptional regulatory protein BURPS1710b_1385 OS=Burkholderia pseudomallei (strain 1710b) GN=BURPS1710b_1385 PE=3 SV=1 6 248 4.0E-18
sp|A3NT48|Y1240_BURP0 Probable transcriptional regulatory protein BURPS1106A_1240 OS=Burkholderia pseudomallei (strain 1106a) GN=BURPS1106A_1240 PE=3 SV=1 6 248 4.0E-18
sp|A3N7F9|Y1231_BURP6 Probable transcriptional regulatory protein BURPS668_1231 OS=Burkholderia pseudomallei (strain 668) GN=BURPS668_1231 PE=3 SV=1 6 248 4.0E-18
sp|Q63VS9|Y1165_BURPS Probable transcriptional regulatory protein BPSL1165 OS=Burkholderia pseudomallei (strain K96243) GN=BPSL1165 PE=3 SV=1 6 248 4.0E-18
sp|Q7W7T8|Y2422_BORPA Probable transcriptional regulatory protein BPP2422 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=BPP2422 PE=3 SV=1 6 249 4.0E-18
sp|Q7WL78|Y1871_BORBR Probable transcriptional regulatory protein BB1871 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=BB1871 PE=3 SV=1 6 249 4.0E-18
sp|Q662Y7|Y025_BORBP Probable transcriptional regulatory protein BG0025 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=BG0025 PE=3 SV=1 6 249 4.0E-18
sp|B1L0B5|Y2466_CLOBM Probable transcriptional regulatory protein CLK_2466 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=CLK_2466 PE=3 SV=1 6 221 4.0E-18
sp|A6TB33|Y2343_KLEP7 Probable transcriptional regulatory protein KPN78578_23430 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=KPN78578_23430 PE=3 SV=1 6 257 4.0E-18
sp|B5XQ02|Y1906_KLEP3 Probable transcriptional regulatory protein KPK_1906 OS=Klebsiella pneumoniae (strain 342) GN=KPK_1906 PE=3 SV=1 6 257 4.0E-18
sp|A7HM20|Y1106_FERNB Probable transcriptional regulatory protein Fnod_1106 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=Fnod_1106 PE=3 SV=1 6 248 5.0E-18
sp|Q3B2D4|Y1643_CHLL7 Probable transcriptional regulatory protein Plut_1643 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=Plut_1643 PE=3 SV=1 6 249 5.0E-18
sp|Q32H97|YEBC_SHIDS Probable transcriptional regulatory protein YebC OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=yebC PE=3 SV=1 6 184 5.0E-18
sp|B3EG35|Y475_CHLL2 Probable transcriptional regulatory protein Clim_0475 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=Clim_0475 PE=3 SV=1 6 171 5.0E-18
sp|Q3Z2M2|YEBC_SHISS Probable transcriptional regulatory protein YebC OS=Shigella sonnei (strain Ss046) GN=yebC PE=3 SV=1 6 184 5.0E-18
sp|P0A8A1|YEBC_SHIFL Probable transcriptional regulatory protein YebC OS=Shigella flexneri GN=yebC PE=3 SV=1 6 184 5.0E-18
sp|P0A8A0|YEBC_ECOLI Probable transcriptional regulatory protein YebC OS=Escherichia coli (strain K12) GN=yebC PE=1 SV=1 6 184 5.0E-18
sp|Q1MRQ1|Y269_LAWIP Probable transcriptional regulatory protein LI0269 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=LI0269 PE=3 SV=1 6 249 5.0E-18
sp|A5V885|Y2142_SPHWW Probable transcriptional regulatory protein Swit_2142 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=Swit_2142 PE=3 SV=1 6 221 5.0E-18
sp|Q2RHT3|Y1704_MOOTA Probable transcriptional regulatory protein Moth_1704 OS=Moorella thermoacetica (strain ATCC 39073) GN=Moth_1704 PE=3 SV=1 6 248 5.0E-18
sp|Q6D499|Y2494_PECAS Probable transcriptional regulatory protein ECA2494 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ECA2494 PE=3 SV=1 6 257 5.0E-18
sp|Q5H2A8|Y1659_XANOR Probable transcriptional regulatory protein XOO1659 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=XOO1659 PE=3 SV=1 23 255 5.0E-18
sp|Q2P579|Y1543_XANOM Probable transcriptional regulatory protein XOO1543 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=XOO1543 PE=3 SV=1 23 255 5.0E-18
sp|Q0AX12|Y1435_SYNWW Probable transcriptional regulatory protein Swol_1435 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=Swol_1435 PE=3 SV=1 6 249 5.0E-18
sp|Q57N98|YEBC_SALCH Probable transcriptional regulatory protein YebC OS=Salmonella choleraesuis (strain SC-B67) GN=yebC PE=3 SV=1 6 257 6.0E-18
sp|Q6KI99|Y1910_MYCMO Probable transcriptional regulatory protein MMOB1910 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=MMOB1910 PE=3 SV=1 6 249 7.0E-18
sp|B7L273|Y946_METC4 Probable transcriptional regulatory protein Mchl_0946 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=Mchl_0946 PE=3 SV=1 6 248 7.0E-18
sp|A4XI43|Y964_CALS8 Probable transcriptional regulatory protein Csac_0964 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=Csac_0964 PE=3 SV=1 6 248 7.0E-18
sp|Q1RAS0|YEBC_ECOUT Probable transcriptional regulatory protein YebC OS=Escherichia coli (strain UTI89 / UPEC) GN=yebC PE=3 SV=1 6 184 7.0E-18
sp|P67175|YEBC_ECOL6 Probable transcriptional regulatory protein YebC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=yebC PE=3 SV=1 6 184 7.0E-18
sp|Q0TGW8|YEBC_ECOL5 Probable transcriptional regulatory protein YebC OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=yebC PE=3 SV=1 6 184 7.0E-18
sp|P67176|YEBC_ECO57 Probable transcriptional regulatory protein YebC OS=Escherichia coli O157:H7 GN=yebC PE=3 SV=1 6 184 7.0E-18
sp|Q3ABX7|Y1525_CARHZ Probable transcriptional regulatory protein CHY_1525 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=CHY_1525 PE=3 SV=1 6 248 7.0E-18
sp|Q31PH2|Y1017_SYNE7 Probable transcriptional regulatory protein Synpcc7942_1017 OS=Synechococcus elongatus (strain PCC 7942) GN=Synpcc7942_1017 PE=3 SV=1 6 249 8.0E-18
sp|Q5FL22|Y733_LACAC Probable transcriptional regulatory protein LBA0733 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=LBA0733 PE=3 SV=1 6 246 8.0E-18
sp|Q2JSH9|Y2259_SYNJA Probable transcriptional regulatory protein CYA_2259 OS=Synechococcus sp. (strain JA-3-3Ab) GN=CYA_2259 PE=3 SV=1 6 248 8.0E-18
sp|Q113G4|Y2125_TRIEI Probable transcriptional regulatory protein Tery_2125 OS=Trichodesmium erythraeum (strain IMS101) GN=Tery_2125 PE=3 SV=1 6 210 8.0E-18
sp|B2U8Z2|Y2388_RALPJ Probable transcriptional regulatory protein Rpic_2388 OS=Ralstonia pickettii (strain 12J) GN=Rpic_2388 PE=3 SV=1 6 248 9.0E-18
sp|Q1WUV3|Y422_LACS1 Probable transcriptional regulatory protein LSL_0422 OS=Lactobacillus salivarius (strain UCC118) GN=LSL_0422 PE=3 SV=1 6 246 1.0E-17
sp|P67179|YEBC_SALTY Probable transcriptional regulatory protein YebC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yebC PE=3 SV=1 6 257 1.0E-17
sp|P67180|YEBC_SALTI Probable transcriptional regulatory protein YebC OS=Salmonella typhi GN=yebC PE=3 SV=1 6 257 1.0E-17
sp|Q5PMZ4|YEBC_SALPA Probable transcriptional regulatory protein YebC OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=yebC PE=3 SV=1 6 257 1.0E-17
sp|C0R1L5|Y1533_BRAHW Probable transcriptional regulatory protein BHWA1_01533 OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=BHWA1_01533 PE=3 SV=1 6 250 1.0E-17
sp|Q01TY1|Y5948_SOLUE Probable transcriptional regulatory protein Acid_5948 OS=Solibacter usitatus (strain Ellin6076) GN=Acid_5948 PE=3 SV=1 6 248 1.0E-17
sp|B2VJ92|Y1487_ERWT9 Probable transcriptional regulatory protein ETA_14870 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ETA_14870 PE=3 SV=1 6 248 1.0E-17
sp|A1W753|Y1898_ACISJ Probable transcriptional regulatory protein Ajs_1898 OS=Acidovorax sp. (strain JS42) GN=Ajs_1898 PE=3 SV=1 6 248 1.0E-17
sp|Q1QWG1|Y1845_CHRSD Probable transcriptional regulatory protein Csal_1845 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=Csal_1845 PE=3 SV=1 6 248 1.0E-17
sp|Q1GFE0|Y1893_RUEST Probable transcriptional regulatory protein TM1040_1893 OS=Ruegeria sp. (strain TM1040) GN=TM1040_1893 PE=3 SV=2 6 248 1.0E-17
sp|O84463|Y457_CHLTR Probable transcriptional regulatory protein CT_457 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=CT_457 PE=3 SV=1 6 249 2.0E-17
sp|Q7NHM8|Y2507_GLOVI Probable transcriptional regulatory protein glr2507 OS=Gloeobacter violaceus (strain PCC 7421) GN=glr2507 PE=3 SV=1 6 232 2.0E-17
sp|A8ZT17|Y371_DESOH Probable transcriptional regulatory protein Dole_0371 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=Dole_0371 PE=3 SV=1 6 248 2.0E-17
sp|B1IMF6|Y1467_CLOBK Probable transcriptional regulatory protein CLD_1467 OS=Clostridium botulinum (strain Okra / Type B1) GN=CLD_1467 PE=3 SV=1 6 221 2.0E-17
sp|Q2SZT0|Y1015_BURTA Probable transcriptional regulatory protein BTH_I1015 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=BTH_I1015 PE=3 SV=1 6 177 2.0E-17
sp|Q1GAZ3|Y677_LACDA Probable transcriptional regulatory protein Ldb0677 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=Ldb0677 PE=3 SV=1 6 229 3.0E-17
sp|Q04BD3|Y609_LACDB Probable transcriptional regulatory protein LBUL_0609 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=LBUL_0609 PE=3 SV=1 6 229 3.0E-17
sp|B4R9L7|Y3068_PHEZH Probable transcriptional regulatory protein PHZ_c3068 OS=Phenylobacterium zucineum (strain HLK1) GN=PHZ_c3068 PE=3 SV=1 6 248 3.0E-17
sp|B4S5F5|Y496_PROA2 Probable transcriptional regulatory protein Paes_0496 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=Paes_0496 PE=3 SV=1 6 143 3.0E-17
sp|Q2JLT1|Y1350_SYNJB Probable transcriptional regulatory protein CYB_1350 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=CYB_1350 PE=3 SV=1 6 248 3.0E-17
sp|Q92HU0|Y681_RICCN Probable transcriptional regulatory protein RC0681 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC0681 PE=3 SV=2 6 264 3.0E-17
sp|Q6LT52|Y1113_PHOPR Probable transcriptional regulatory protein PBPRA1113 OS=Photobacterium profundum GN=PBPRA1113 PE=3 SV=1 6 248 3.0E-17
sp|P94447|YRBC_BACSU Probable transcriptional regulatory protein YrbC OS=Bacillus subtilis (strain 168) GN=yrbC PE=3 SV=2 6 250 4.0E-17
sp|Q1IW96|Y2194_DEIGD Probable transcriptional regulatory protein Dgeo_2194 OS=Deinococcus geothermalis (strain DSM 11300) GN=Dgeo_2194 PE=3 SV=1 6 248 4.0E-17
sp|B3R3E4|Y859_CUPTR Probable transcriptional regulatory protein RALTA_A0859 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=RALTA_A0859 PE=3 SV=1 6 248 4.0E-17
sp|Q65GN7|Y2909_BACLD Probable transcriptional regulatory protein BLi02909/BL01150 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=BLi02909 PE=3 SV=1 6 249 4.0E-17
sp|B2S1L3|Y025_BORHD Probable transcriptional regulatory protein BH0025 OS=Borrelia hermsii (strain HS1 / DAH) GN=BH0025 PE=3 SV=1 6 249 4.0E-17
sp|B0B830|Y717_CHLT2 Probable transcriptional regulatory protein CTL0717 OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=CTL0717 PE=3 SV=1 6 249 4.0E-17
sp|B0BC95|Y713_CHLTB Probable transcriptional regulatory protein CTLon_0713 OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=CTLon_0713 PE=3 SV=1 6 249 4.0E-17
sp|Q3KLP1|Y499_CHLTA Probable transcriptional regulatory protein CTA_0499 OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=CTA_0499 PE=3 SV=1 6 249 4.0E-17
sp|A4YMC4|Y1143_BRASO Probable transcriptional regulatory protein BRADO1143 OS=Bradyrhizobium sp. (strain ORS278) GN=BRADO1143 PE=3 SV=1 6 248 5.0E-17
sp|B0S1S1|Y893_FINM2 Probable transcriptional regulatory protein FMG_0893 OS=Finegoldia magna (strain ATCC 29328) GN=FMG_0893 PE=3 SV=1 6 248 5.0E-17
sp|Q9PJT5|Y742_CHLMU Probable transcriptional regulatory protein TC_0742 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=TC_0742 PE=3 SV=1 6 249 5.0E-17
sp|A8YUH0|Y777_LACH4 Probable transcriptional regulatory protein lhv_0777 OS=Lactobacillus helveticus (strain DPC 4571) GN=lhv_0777 PE=3 SV=1 6 246 5.0E-17
sp|A5WE72|Y1013_PSYWF Probable transcriptional regulatory protein PsycPRwf_1013 OS=Psychrobacter sp. (strain PRwf-1) GN=PsycPRwf_1013 PE=3 SV=1 6 249 5.0E-17
sp|Q9RRE4|Y2548_DEIRA Probable transcriptional regulatory protein DR_2548 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=DR_2548 PE=3 SV=1 6 248 5.0E-17
sp|A9QYX6|Y2424_YERPG Probable transcriptional regulatory protein YpAngola_A2424 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=YpAngola_A2424 PE=3 SV=1 6 257 5.0E-17
sp|B2K321|Y2097_YERPB Probable transcriptional regulatory protein YPTS_2097 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=YPTS_2097 PE=3 SV=1 6 257 5.0E-17
sp|Q8ZEU8|Y2055_YERPE Probable transcriptional regulatory protein YPO2055/y2255/YP_1898 OS=Yersinia pestis GN=YPO2055 PE=3 SV=1 6 257 5.0E-17
sp|Q66AU2|Y2038_YERPS Probable transcriptional regulatory protein YPTB2038 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=YPTB2038 PE=3 SV=1 6 257 5.0E-17
sp|A7FIC8|Y2033_YERP3 Probable transcriptional regulatory protein YpsIP31758_2033 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=YpsIP31758_2033 PE=3 SV=1 6 257 5.0E-17
sp|Q1CJG8|Y1532_YERPN Probable transcriptional regulatory protein YPN_1532 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=YPN_1532 PE=3 SV=1 6 257 5.0E-17
sp|Q1C818|Y1437_YERPA Probable transcriptional regulatory protein YPA_1437 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=YPA_1437 PE=3 SV=1 6 257 5.0E-17
sp|A4TJK3|Y1067_YERPP Probable transcriptional regulatory protein YPDSF_1067 OS=Yersinia pestis (strain Pestoides F) GN=YPDSF_1067 PE=3 SV=1 6 257 5.0E-17
sp|A1JRK5|Y2395_YERE8 Probable transcriptional regulatory protein YE2395 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=YE2395 PE=3 SV=1 6 257 6.0E-17
sp|Q3AU82|Y165_CHLCH Probable transcriptional regulatory protein Cag_0165 OS=Chlorobium chlorochromatii (strain CaD3) GN=Cag_0165 PE=3 SV=2 6 249 6.0E-17
sp|B3QHR9|Y1287_RHOPT Probable transcriptional regulatory protein Rpal_1287 OS=Rhodopseudomonas palustris (strain TIE-1) GN=Rpal_1287 PE=3 SV=1 6 264 7.0E-17
sp|P62040|Y1097_RHOPA Probable transcriptional regulatory protein RPA1097 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=RPA1097 PE=3 SV=1 6 264 7.0E-17
sp|B0JTZ2|Y1358_MICAN Probable transcriptional regulatory protein MAE_13580 OS=Microcystis aeruginosa (strain NIES-843) GN=MAE_13580 PE=3 SV=1 6 248 7.0E-17
sp|C3PNU7|Y717_RICAE Probable transcriptional regulatory protein RAF_ORF0717 OS=Rickettsia africae (strain ESF-5) GN=RAF_ORF0717 PE=3 SV=1 6 264 8.0E-17
sp|B5RLN2|Y030_BORDL Probable transcriptional regulatory protein BDU_30 OS=Borrelia duttonii (strain Ly) GN=BDU_30 PE=3 SV=1 6 257 8.0E-17
sp|B1LUU4|Y3553_METRJ Probable transcriptional regulatory protein Mrad2831_3553 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=Mrad2831_3553 PE=3 SV=1 6 248 8.0E-17
sp|B5RQK7|Y029_BORRA Probable transcriptional regulatory protein BRE_29 OS=Borrelia recurrentis (strain A1) GN=BRE_29 PE=3 SV=1 6 257 9.0E-17
sp|A5IJV5|Y454_THEP1 Probable transcriptional regulatory protein Tpet_0454 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=Tpet_0454 PE=3 SV=1 6 248 9.0E-17
sp|Q3BQF0|Y3282_XANC5 Probable transcriptional regulatory protein XCV3282 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=XCV3282 PE=3 SV=1 19 255 1.0E-16
sp|Q04FS7|Y768_OENOB Probable transcriptional regulatory protein OEOE_0768 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=OEOE_0768 PE=3 SV=1 6 246 1.0E-16
sp|A5ERK3|Y6910_BRASB Probable transcriptional regulatory protein BBta_6910 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=BBta_6910 PE=3 SV=1 6 248 1.0E-16
sp|Q2SCK9|Y4926_HAHCH Probable transcriptional regulatory protein HCH_04926 OS=Hahella chejuensis (strain KCTC 2396) GN=HCH_04926 PE=3 SV=1 6 248 1.0E-16
sp|A9BHC2|Y807_PETMO Probable transcriptional regulatory protein Pmob_0807 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=Pmob_0807 PE=3 SV=1 6 248 1.0E-16
sp|B8E2P4|Y1615_DICTD Probable transcriptional regulatory protein Dtur_1615 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=Dtur_1615 PE=3 SV=1 6 248 1.0E-16
sp|A8MHN6|Y1778_ALKOO Probable transcriptional regulatory protein Clos_1778 OS=Alkaliphilus oremlandii (strain OhILAs) GN=Clos_1778 PE=3 SV=1 19 248 1.0E-16
sp|Q5L6U7|Y166_CHLAB Probable transcriptional regulatory protein CAB166 OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=CAB166 PE=3 SV=1 6 249 1.0E-16
sp|B1L927|Y469_THESQ Probable transcriptional regulatory protein TRQ2_0469 OS=Thermotoga sp. (strain RQ2) GN=TRQ2_0469 PE=3 SV=1 6 248 1.0E-16
sp|B3WD20|Y1186_LACCB Probable transcriptional regulatory protein LCABL_11860 OS=Lactobacillus casei (strain BL23) GN=LCABL_11860 PE=3 SV=1 6 246 1.0E-16
sp|B8EIB7|Y2305_METSB Probable transcriptional regulatory protein Msil_2305 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=Msil_2305 PE=3 SV=1 6 248 2.0E-16
sp|B1JLL3|Y2146_YERPY Probable transcriptional regulatory protein YPK_2146 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=YPK_2146 PE=3 SV=1 6 257 2.0E-16
sp|Q88V33|Y2253_LACPL Probable transcriptional regulatory protein lp_2253 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lp_2253 PE=3 SV=1 6 246 2.0E-16
sp|B6JJ00|Y7305_OLICO Probable transcriptional regulatory protein OCAR_7305/OCA5_c08120 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=OCAR_7305 PE=3 SV=1 6 264 2.0E-16
sp|Q9WYT7|Y466_THEMA Probable transcriptional regulatory protein TM_0466 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0466 PE=3 SV=2 6 248 2.0E-16
sp|Q8U9K1|Y3727_AGRFC Probable transcriptional regulatory protein Atu3727 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=Atu3727 PE=3 SV=1 6 248 2.0E-16
sp|Q03AF5|Y1022_LACC3 Probable transcriptional regulatory protein LSEI_1022 OS=Lactobacillus casei (strain ATCC 334) GN=LSEI_1022 PE=3 SV=1 6 246 2.0E-16
sp|Q46YA0|Y2522_CUPPJ Probable transcriptional regulatory protein Reut_A2522 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=Reut_A2522 PE=3 SV=1 6 248 2.0E-16
sp|Q4K9M3|Y3960_PSEF5 Probable transcriptional regulatory protein PFL_3960 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=PFL_3960 PE=3 SV=1 11 249 2.0E-16
sp|Q1LQA5|Y785_CUPMC Probable transcriptional regulatory protein Rmet_0785 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=Rmet_0785 PE=3 SV=1 6 248 2.0E-16
sp|A6LLP5|Y985_THEM4 Probable transcriptional regulatory protein Tmel_0985 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=Tmel_0985 PE=3 SV=1 6 248 2.0E-16
sp|A1VC41|Y986_DESVV Probable transcriptional regulatory protein Dvul_0986 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=Dvul_0986 PE=3 SV=1 6 248 2.0E-16
sp|A4IRB5|Y2524_GEOTN Probable transcriptional regulatory protein GTNG_2524 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=GTNG_2524 PE=3 SV=1 6 256 2.0E-16
sp|Q30YX4|Y2325_DESAG Probable transcriptional regulatory protein Dde_2325 OS=Desulfovibrio alaskensis (strain G20) GN=Dde_2325 PE=3 SV=1 6 248 3.0E-16
sp|P62033|Y1964_BDEBA Probable transcriptional regulatory protein Bd1964 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=Bd1964 PE=3 SV=1 22 246 3.0E-16
sp|Q4ULC3|Y799_RICFE Probable transcriptional regulatory protein RF_0799 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0799 PE=3 SV=1 6 264 3.0E-16
sp|A8GVY2|Y3240_RICB8 Probable transcriptional regulatory protein A1I_03240 OS=Rickettsia bellii (strain OSU 85-389) GN=A1I_03240 PE=3 SV=1 6 248 3.0E-16
sp|B1XP37|Y1640_SYNP2 Probable transcriptional regulatory protein SYNPCC7002_A1640 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=SYNPCC7002_A1640 PE=3 SV=1 6 249 4.0E-16
sp|B4SDW5|Y657_PELPB Probable transcriptional regulatory protein Ppha_0657 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=Ppha_0657 PE=3 SV=1 6 170 4.0E-16
sp|Q2RZ66|Y2667_SALRD Probable transcriptional regulatory protein SRU_2667 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=SRU_2667 PE=3 SV=2 6 242 4.0E-16
sp|C5CGU7|Y1935_KOSOT Probable transcriptional regulatory protein Kole_1935 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=Kole_1935 PE=3 SV=1 6 248 4.0E-16
sp|Q04YE4|Y2537_LEPBL Probable transcriptional regulatory protein LBL_2537 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=LBL_2537 PE=3 SV=1 6 230 6.0E-16
sp|B2A5L8|Y1800_NATTJ Probable transcriptional regulatory protein Nther_1800 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=Nther_1800 PE=3 SV=1 6 248 6.0E-16
sp|A8GNY3|Y4175_RICAH Probable transcriptional regulatory protein A1C_04175 OS=Rickettsia akari (strain Hartford) GN=A1C_04175 PE=3 SV=1 6 264 6.0E-16
sp|B1WS51|Y894_CYAA5 Probable transcriptional regulatory protein cce_0894 OS=Cyanothece sp. (strain ATCC 51142) GN=cce_0894 PE=3 SV=1 6 248 6.0E-16
sp|C4Z5P5|Y902_EUBE2 Probable transcriptional regulatory protein EUBELI_00902 OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=EUBELI_00902 PE=3 SV=1 6 248 7.0E-16
sp|A6Q2G5|Y560_NITSB Probable transcriptional regulatory protein NIS_0560 OS=Nitratiruptor sp. (strain SB155-2) GN=NIS_0560 PE=3 SV=1 6 250 7.0E-16
sp|Q6AJ43|Y2908_DESPS Probable transcriptional regulatory protein DP2908 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=DP2908 PE=3 SV=1 6 248 8.0E-16
sp|B7IHX7|Y1246_THEAB Probable transcriptional regulatory protein THA_1246 OS=Thermosipho africanus (strain TCF52B) GN=THA_1246 PE=3 SV=1 6 248 8.0E-16
sp|P62035|Y2259_DESVH Probable transcriptional regulatory protein DVU_2259 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=DVU_2259 PE=3 SV=1 6 248 8.0E-16
sp|P62043|Y484_WOLPM Probable transcriptional regulatory protein WD_0484 OS=Wolbachia pipientis wMel GN=WD_0484 PE=3 SV=1 6 248 8.0E-16
sp|Q1RJ15|Y568_RICBR Probable transcriptional regulatory protein RBE_0568 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0568 PE=3 SV=1 6 248 8.0E-16
sp|B0VC84|Y2155_ACIBY Probable transcriptional regulatory protein ABAYE2155 OS=Acinetobacter baumannii (strain AYE) GN=ABAYE2155 PE=3 SV=1 6 249 9.0E-16
sp|B0VR58|Y2152_ACIBS Probable transcriptional regulatory protein ABSDF2152 OS=Acinetobacter baumannii (strain SDF) GN=ABSDF2152 PE=3 SV=1 6 249 9.0E-16
sp|B7H3U3|Y1989_ACIB3 Probable transcriptional regulatory protein ABBFA_001989 OS=Acinetobacter baumannii (strain AB307-0294) GN=ABBFA_001989 PE=3 SV=1 6 249 9.0E-16
sp|B7I4G5|Y1731_ACIB5 Probable transcriptional regulatory protein AB57_1731 OS=Acinetobacter baumannii (strain AB0057) GN=AB57_1731 PE=3 SV=1 6 249 9.0E-16
sp|B2HYW1|Y1536_ACIBC Probable transcriptional regulatory protein ACICU_01536 OS=Acinetobacter baumannii (strain ACICU) GN=ACICU_01536 PE=3 SV=1 6 249 9.0E-16
sp|Q253C8|Y838_CHLFF Probable transcriptional regulatory protein CF0838 OS=Chlamydophila felis (strain Fe/C-56) GN=CF0838 PE=3 SV=1 6 249 9.0E-16
sp|Q5SK31|Y821_THET8 Probable transcriptional regulatory protein TTHA0821 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0821 PE=3 SV=1 6 249 1.0E-15
sp|P62041|Y469_THET2 Probable transcriptional regulatory protein TT_C0469 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=TT_C0469 PE=3 SV=1 6 249 1.0E-15
sp|Q04V34|Y543_LEPBJ Probable transcriptional regulatory protein LBJ_0543 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=LBJ_0543 PE=3 SV=1 6 230 1.0E-15
sp|A3M4T0|Y1496_ACIBT Probable transcriptional regulatory protein A1S_1496 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=A1S_1496 PE=3 SV=2 6 249 1.0E-15
sp|B2GB45|Y541_LACF3 Probable transcriptional regulatory protein LAF_0541 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=LAF_0541 PE=3 SV=1 6 246 1.0E-15
sp|Q8F839|Y720_LEPIN Probable transcriptional regulatory protein LA_0720 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=LA_0720 PE=3 SV=1 6 248 1.0E-15
sp|P62038|Y2886_LEPIC Probable transcriptional regulatory protein LIC_12886 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=LIC_12886 PE=3 SV=1 6 248 1.0E-15
sp|A1BDW8|Y538_CHLPD Probable transcriptional regulatory protein Cpha266_0538 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=Cpha266_0538 PE=3 SV=1 6 143 1.0E-15
sp|Q9Z7Y0|Y573_CHLPN Probable transcriptional regulatory protein CPn_0573/CP_0176/CPj0573/CpB0595 OS=Chlamydia pneumoniae GN=CPn_0573 PE=3 SV=1 6 249 2.0E-15
sp|Q11DG1|Y3192_CHESB Probable transcriptional regulatory protein Meso_3192 OS=Chelativorans sp. (strain BNC1) GN=Meso_3192 PE=3 SV=1 6 248 2.0E-15
sp|Q838A9|Y663_ENTFA Probable transcriptional regulatory protein EF_0663 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=EF_0663 PE=3 SV=1 6 246 2.0E-15
sp|Q1MC59|Y3983_RHIL3 Probable transcriptional regulatory protein RL3983 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=RL3983 PE=3 SV=1 6 248 2.0E-15
sp|B8J4I9|Y536_DESDA Probable transcriptional regulatory protein Ddes_0536 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=Ddes_0536 PE=3 SV=1 6 249 3.0E-15
sp|Q92BH9|Y1570_LISIN Probable transcriptional regulatory protein lin1570 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin1570 PE=3 SV=1 6 248 3.0E-15
sp|C4XIK1|Y3085_DESMR Probable transcriptional regulatory protein DMR_30850 OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=DMR_30850 PE=3 SV=1 6 148 3.0E-15
sp|Q824H7|Y169_CHLCV Probable transcriptional regulatory protein CCA_00169 OS=Chlamydophila caviae (strain GPIC) GN=CCA_00169 PE=3 SV=1 6 249 3.0E-15
sp|Q3K9Y9|Y3677_PSEPF Probable transcriptional regulatory protein Pfl01_3677 OS=Pseudomonas fluorescens (strain Pf0-1) GN=Pfl01_3677 PE=3 SV=1 11 249 3.0E-15
sp|Q97GS1|Y2295_CLOAB Probable transcriptional regulatory protein CA_C2295 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C2295 PE=3 SV=1 6 248 3.0E-15
sp|Q5KWQ7|Y2594_GEOKA Probable transcriptional regulatory protein GK2594 OS=Geobacillus kaustophilus (strain HTA426) GN=GK2594 PE=3 SV=2 6 256 3.0E-15
sp|A8EYL6|Y2520_RICCK Probable transcriptional regulatory protein A1E_02520 OS=Rickettsia canadensis (strain McKiel) GN=A1E_02520 PE=3 SV=1 6 264 3.0E-15
sp|Q21WQ3|Y2075_RHOFT Probable transcriptional regulatory protein Rfer_2075 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=Rfer_2075 PE=3 SV=1 6 183 3.0E-15
sp|Q891Z5|Y2215_CLOTE Probable transcriptional regulatory protein CTC_02215 OS=Clostridium tetani (strain Massachusetts / E88) GN=CTC_02215 PE=3 SV=1 6 248 3.0E-15
sp|B8HYK3|Y4347_CYAP4 Probable transcriptional regulatory protein Cyan7425_4347 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=Cyan7425_4347 PE=3 SV=1 6 160 3.0E-15
sp|Q2GBA6|Y419_NOVAD Probable transcriptional regulatory protein Saro_0419 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=Saro_0419 PE=3 SV=1 6 248 4.0E-15
sp|Q4FN26|Y592_PELUB Probable transcriptional regulatory protein SAR11_0592 OS=Pelagibacter ubique (strain HTCC1062) GN=SAR11_0592 PE=3 SV=1 6 250 4.0E-15
sp|C0R5P2|Y2620_WOLWR Probable transcriptional regulatory protein WRi_002620 OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=WRi_002620 PE=3 SV=1 6 248 4.0E-15
sp|A8GSK9|Y4400_RICRS Probable transcriptional regulatory protein A1G_04400 OS=Rickettsia rickettsii (strain Sheila Smith) GN=A1G_04400 PE=3 SV=1 6 264 4.0E-15
sp|Q71ZD5|Y1554_LISMF Probable transcriptional regulatory protein LMOf2365_1554 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=LMOf2365_1554 PE=3 SV=1 6 248 4.0E-15
sp|Q5NR77|Y153_ZYMMO Probable transcriptional regulatory protein ZMO0153 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=ZMO0153 PE=3 SV=1 6 248 5.0E-15
sp|A1UR98|Y163_BARBK Probable transcriptional regulatory protein BARBAKC583_0163 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=BARBAKC583_0163 PE=3 SV=1 6 248 5.0E-15
sp|B8DNJ5|Y3201_DESVM Probable transcriptional regulatory protein DvMF_3201 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=DvMF_3201 PE=3 SV=1 6 248 6.0E-15
sp|B2FRN8|Y3713_STRMK Probable transcriptional regulatory protein Smlt3713 OS=Stenotrophomonas maltophilia (strain K279a) GN=Smlt3713 PE=3 SV=1 35 196 7.0E-15
sp|A9KMB4|Y2507_CLOPH Probable transcriptional regulatory protein Cphy_2507 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=Cphy_2507 PE=3 SV=1 6 212 8.0E-15
sp|Q8KBW7|Y1665_CHLTE Probable transcriptional regulatory protein CT1665 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT1665 PE=3 SV=1 6 249 9.0E-15
sp|Q6FYQ2|Y1179_BARQU Probable transcriptional regulatory protein BQ11790 OS=Bartonella quintana (strain Toulouse) GN=BQ11790 PE=3 SV=1 6 262 1.0E-14
sp|Q6G5P2|Y1481_BARHE Probable transcriptional regulatory protein BH14810 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=BH14810 PE=3 SV=1 6 262 1.0E-14
sp|B3ES20|Y624_AMOA5 Probable transcriptional regulatory protein Aasi_0624 OS=Amoebophilus asiaticus (strain 5a2) GN=Aasi_0624 PE=3 SV=1 6 249 1.0E-14
sp|A9B4U5|Y3030_HERA2 Probable transcriptional regulatory protein Haur_3030 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=Haur_3030 PE=3 SV=1 6 249 1.0E-14
sp|A6M152|Y4222_CLOB8 Probable transcriptional regulatory protein Cbei_4222 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=Cbei_4222 PE=3 SV=1 6 221 1.0E-14
sp|B1Z942|Y922_METPB Probable transcriptional regulatory protein Mpop_0922 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=Mpop_0922 PE=3 SV=1 6 248 1.0E-14
sp|Q8P6E3|Y3027_XANCP Probable transcriptional regulatory protein XCC3027 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC3027 PE=3 SV=1 35 255 1.0E-14
sp|B0RPY2|Y1169_XANCB Probable transcriptional regulatory protein xcc-b100_1169 OS=Xanthomonas campestris pv. campestris (strain B100) GN=xcc-b100_1169 PE=3 SV=1 35 255 1.0E-14
sp|Q4UXM2|Y1131_XANC8 Probable transcriptional regulatory protein XC_1131 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=XC_1131 PE=3 SV=1 35 255 1.0E-14
sp|Q2GGC4|Y704_EHRCR Probable transcriptional regulatory protein ECH_0704 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=ECH_0704 PE=3 SV=1 6 249 1.0E-14
sp|A1WQN6|Y4238_VEREI Probable transcriptional regulatory protein Veis_4238 OS=Verminephrobacter eiseniae (strain EF01-2) GN=Veis_4238 PE=3 SV=1 6 196 2.0E-14
sp|Q03R67|Y1199_LACBA Probable transcriptional regulatory protein LVIS_1199 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=LVIS_1199 PE=3 SV=1 6 206 2.0E-14
sp|A9IYI8|Y2363_BART1 Probable transcriptional regulatory protein BT_2363 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=BT_2363 PE=3 SV=1 6 262 2.0E-14
sp|A9WWJ3|Y3692_BRUSI Probable transcriptional regulatory protein BSUIS_B1192 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=BSUIS_B1192 PE=3 SV=1 6 248 3.0E-14
sp|P67173|Y321_BRUME Probable transcriptional regulatory protein BMEI0321 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=BMEI0321 PE=3 SV=1 6 248 3.0E-14
sp|C0REX9|Y1769_BRUMB Probable transcriptional regulatory protein BMEA_A1769 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=BMEA_A1769 PE=3 SV=1 6 248 3.0E-14
sp|A9M7L4|Y1755_BRUC2 Probable transcriptional regulatory protein BCAN_A1755 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=BCAN_A1755 PE=3 SV=1 6 248 3.0E-14
sp|Q2YRF2|Y1729_BRUA2 Probable transcriptional regulatory protein BAB1_1729 OS=Brucella abortus (strain 2308) GN=BAB1_1729 PE=3 SV=1 6 248 3.0E-14
sp|P67174|Y1717_BRUSU Probable transcriptional regulatory protein BR1717/BS1330_I1711 OS=Brucella suis biovar 1 (strain 1330) GN=BR1717 PE=3 SV=1 6 248 3.0E-14
sp|Q57BG3|Y1702_BRUAB Probable transcriptional regulatory protein BruAb1_1702 OS=Brucella abortus biovar 1 (strain 9-941) GN=BruAb1_1702 PE=3 SV=1 6 248 3.0E-14
sp|A5VS72|Y1660_BRUO2 Probable transcriptional regulatory protein BOV_1660 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=BOV_1660 PE=3 SV=1 6 248 3.0E-14
sp|B5YFL4|Y1505_DICT6 Probable transcriptional regulatory protein DICTH_1505 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=DICTH_1505 PE=3 SV=1 6 248 3.0E-14
sp|A0PZU0|Y1819_CLONN Probable transcriptional regulatory protein NT01CX_1819 OS=Clostridium novyi (strain NT) GN=NT01CX_1819 PE=3 SV=1 6 248 4.0E-14
sp|Q98F44|Y3945_RHILO Probable transcriptional regulatory protein mll3945 OS=Rhizobium loti (strain MAFF303099) GN=mll3945 PE=3 SV=1 6 262 4.0E-14
sp|C4K280|Y5505_RICPU Probable transcriptional regulatory protein RPR_05505 OS=Rickettsia peacockii (strain Rustic) GN=RPR_05505 PE=3 SV=1 6 264 4.0E-14
sp|Q5HBG4|Y377_EHRRW Probable transcriptional regulatory protein Erum3660/ERWE_CDS_03770 OS=Ehrlichia ruminantium (strain Welgevonden) GN=Erum3660 PE=3 SV=1 6 249 6.0E-14
sp|Q5FHN8|Y372_EHRRG Probable transcriptional regulatory protein ERGA_CDS_03720 OS=Ehrlichia ruminantium (strain Gardel) GN=ERGA_CDS_03720 PE=3 SV=1 6 249 6.0E-14
sp|B8H462|Y3352_CAUCN Probable transcriptional regulatory protein CCNA_03352 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=CCNA_03352 PE=3 SV=1 6 248 6.0E-14
sp|Q9A3G1|Y3243_CAUCR Probable transcriptional regulatory protein CC_3243 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=CC_3243 PE=3 SV=1 6 248 6.0E-14
sp|Q98PU5|Y624_MYCPU Probable transcriptional regulatory protein MYPU_6240 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=MYPU_6240 PE=3 SV=1 6 249 7.0E-14
sp|A1AW54|Y394_RUTMC Probable transcriptional regulatory protein Rmag_0394 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=Rmag_0394 PE=3 SV=1 6 248 8.0E-14
sp|Q67QQ4|Y1004_SYMTH Probable transcriptional regulatory protein STH1004 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=STH1004 PE=3 SV=1 11 248 1.0E-13
sp|B3CNE0|Y1214_WOLPP Probable transcriptional regulatory protein WP1214 OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=WP1214 PE=3 SV=1 6 248 1.0E-13
sp|Q2K4K5|Y3475_RHIEC Probable transcriptional regulatory protein RHE_CH03475 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=RHE_CH03475 PE=3 SV=1 6 248 1.0E-13
sp|B9JRY6|Y3631_AGRVS Probable transcriptional regulatory protein Avi_3631 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=Avi_3631 PE=3 SV=1 6 248 1.0E-13
sp|Q5GRW6|Y670_WOLTR Probable transcriptional regulatory protein Wbm0670 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=Wbm0670 PE=3 SV=1 6 248 1.0E-13
sp|Q8Y6Z5|Y1535_LISMO Probable transcriptional regulatory protein lmo1535 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo1535 PE=3 SV=1 6 248 2.0E-13
sp|B4ST36|Y3128_STRM5 Probable transcriptional regulatory protein Smal_3128 OS=Stenotrophomonas maltophilia (strain R551-3) GN=Smal_3128 PE=3 SV=1 35 196 2.0E-13
sp|B0SUN3|Y780_CAUSK Probable transcriptional regulatory protein Caul_0780 OS=Caulobacter sp. (strain K31) GN=Caul_0780 PE=3 SV=1 6 248 2.0E-13
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4924
MTAAPLAGHNKWSKTKHIKAVVDKKKQNERMSYAKRIAMFSRMYGDDVNSNAQLAHAVAAATKASVPKALVEAAI
ARGQGRSATGAQLESMTIEILLPPNMALIADVETDNKSRTLADLKLAAKRCDGVFGSTSFYFSRRGRIVFAPKPD
DGPSLSDMLEEAIELDGADDVEELPDGGYRAWTQPTALMMVTEGLSRKFGLEVLESDIIWAPNADTTVAVDCQQS
VESLDSLLSSIREYPEVKAVFANVRQGAVADDGWAKVMGHIDV*
Coding >Hirsu2|4924
ATGACGGCCGCGCCGCTCGCGGGCCACAACAAGTGGTCCAAGACGAAGCACATCAAGGCCGTGGTGGACAAGAAG
AAGCAGAACGAGCGAATGTCATACGCCAAGCGCATCGCCATGTTCTCGCGAATGTACGGAGACGACGTCAATTCG
AACGCGCAATTGGCACACGCAGTCGCAGCGGCCACCAAAGCCAGCGTGCCCAAGGCTTTGGTGGAGGCGGCGATC
GCGCGAGGCCAGGGCCGTTCGGCGACGGGCGCGCAGCTCGAAAGCATGACCATCGAGATCCTGCTGCCGCCGAAC
ATGGCGCTCATCGCCGACGTCGAGACGGACAACAAGTCGCGCACGCTGGCCGACCTCAAGTTGGCGGCCAAGAGG
TGCGACGGCGTCTTCGGCTCGACCTCGTTCTACTTCTCACGGCGCGGCCGCATCGTCTTCGCGCCCAAGCCGGAC
GACGGCCCCTCGCTGTCGGACATGCTGGAGGAGGCCATTGAGCTCGACGGCGCCGACGACGTCGAGGAGCTGCCG
GACGGCGGGTACCGGGCGTGGACGCAGCCGACGGCGCTCATGATGGTCACCGAGGGGCTGAGCAGGAAGTTCGGG
CTCGAGGTGCTCGAGTCGGACATCATCTGGGCGCCCAACGCCGACACGACAGTCGCCGTAGACTGTCAGCAATCG
GTAGAAAGCCTGGACAGCCTCCTGTCCAGCATCAGAGAGTACCCGGAAGTCAAGGCGGTCTTTGCCAACGTCCGG
CAGGGGGCCGTCGCCGACGACGGTTGGGCCAAGGTGATGGGGCACATAGACGTATGA
Transcript >Hirsu2|4924
ATGACGGCCGCGCCGCTCGCGGGCCACAACAAGTGGTCCAAGACGAAGCACATCAAGGCCGTGGTGGACAAGAAG
AAGCAGAACGAGCGAATGTCATACGCCAAGCGCATCGCCATGTTCTCGCGAATGTACGGAGACGACGTCAATTCG
AACGCGCAATTGGCACACGCAGTCGCAGCGGCCACCAAAGCCAGCGTGCCCAAGGCTTTGGTGGAGGCGGCGATC
GCGCGAGGCCAGGGCCGTTCGGCGACGGGCGCGCAGCTCGAAAGCATGACCATCGAGATCCTGCTGCCGCCGAAC
ATGGCGCTCATCGCCGACGTCGAGACGGACAACAAGTCGCGCACGCTGGCCGACCTCAAGTTGGCGGCCAAGAGG
TGCGACGGCGTCTTCGGCTCGACCTCGTTCTACTTCTCACGGCGCGGCCGCATCGTCTTCGCGCCCAAGCCGGAC
GACGGCCCCTCGCTGTCGGACATGCTGGAGGAGGCCATTGAGCTCGACGGCGCCGACGACGTCGAGGAGCTGCCG
GACGGCGGGTACCGGGCGTGGACGCAGCCGACGGCGCTCATGATGGTCACCGAGGGGCTGAGCAGGAAGTTCGGG
CTCGAGGTGCTCGAGTCGGACATCATCTGGGCGCCCAACGCCGACACGACAGTCGCCGTAGACTGTCAGCAATCG
GTAGAAAGCCTGGACAGCCTCCTGTCCAGCATCAGAGAGTACCCGGAAGTCAAGGCGGTCTTTGCCAACGTCCGG
CAGGGGGCCGTCGCCGACGACGGTTGGGCCAAGGTGATGGGGCACATAGACGTATGA
Gene >Hirsu2|4924
ATGACGGCCGCGCCGCTCGCGGGCCACAACAAGTGGTCCAAGACGAAGCACATCAAGGCCGTGGTGGACAAGAAG
AAGCAGAACGAGCGAATGTCATACGCCAAGCGCATCGCCATGTTCTCGCGAAGTCAGCCGCCACCTCAGCCACTG
CGTTTAGTGTAAACAGGCGCCAGCCGCGCGCCAAGTCTGACCCATGGGACGCAGTGTACGGAGACGACGTCAATT
CGAACGCGCAATTGGCACACGCAGTCGCAGCGGCCACCAAAGGTAAACCACATCAATTTTCCCGGCCCCACGTCC
GTCACGCTGAACCCGGCACGGGAGCAGCCAGCGTGCCCAAGGCTTTGGTGGAGGCGGCGATCGCGCGAGGCCAGG
GCCGTTCGGCGACGGGCGCGCAGCTCGAAAGCATGACCATCGAGATCCTGCTGCCGCCGAACATGGCGCTCATCG
CCGACGTCGAGACGGACAACAAGTCGCGCACGCTGGCCGACCTCAAGTTGGCGGCCAAGAGGTGCGACGGCGTCT
TCGGCTCGACCTCGTTCTACTTCTCACGGCGCGGCCGCATCGTCTTCGCGCCCAAGCCGGACGACGGCCCCTCGC
TGTCGGACATGCTGGAGGAGGCCATTGAGCTCGACGGCGCCGACGACGTCGAGGAGCTGCCGGACGGCGGGTACC
GGGCGTGGACGCAGCCGACGGCGCTCATGATGGTCACCGAGGGGCTGAGCAGGAAGTTCGGGCTCGAGGTGCTCG
AGTCGGACATCATCTGGGCGCCCAACGCCGACACGACAGTCGCCGTAGACTGTCAGCAATCGGTAGAAAGCCTGG
ACAGCCTCCTGTCCAGCATCAGAGAGTACCCGGAAGTCAAGGCGGTCTTTGCCAACGTCCGGCAGGGGGCCGTCG
CCGACGACGGTTGGGCCAAGGTGATGGGGCACATAGACGTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail