Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4923
Gene name
LocationContig_248:2030..2381
Strand+
Gene length (bp)351
Transcript length (bp)267
Coding sequence length (bp)267
Protein length (aa) 89

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09803 Pet100 Pet100 2.6E-18 1 77

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38958|PT100_YEAST Protein PET100, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET100 PE=1 SV=1 5 77 2.0E-12

GO

GO Term Description Terminal node
GO:0005739 mitochondrion Yes
GO:0033617 mitochondrial respiratory chain complex IV assembly Yes
GO:0043933 protein-containing complex subunit organization No
GO:0044424 intracellular part No
GO:0016043 cellular component organization No
GO:0071840 cellular component organization or biogenesis No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0043231 intracellular membrane-bounded organelle No
GO:0022607 cellular component assembly No
GO:0043229 intracellular organelle No
GO:0017004 cytochrome complex assembly No
GO:0034622 cellular protein-containing complex assembly No
GO:0065003 protein-containing complex assembly No
GO:0033108 mitochondrial respiratory chain complex assembly No
GO:0008150 biological_process No
GO:0043226 organelle No
GO:0008535 respiratory chain complex IV assembly No
GO:0005575 cellular_component No
GO:0043227 membrane-bounded organelle No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 4 26 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4923
MGGLNLEVFKFGMYVMFPIGIMYYFGTNLDDRFAVRNFWPRPEECNKVPGDRDEVRAEYERIVSRQRRLQVQRRA
EEAQRNGHKEDES*
Coding >Hirsu2|4923
ATGGGCGGCCTCAACCTCGAGGTTTTCAAGTTCGGCATGTACGTCATGTTCCCGATCGGCATCATGTATTACTTC
GGTACCAACCTCGACGACCGATTCGCCGTCCGCAACTTCTGGCCCCGGCCCGAGGAGTGCAACAAGGTGCCCGGC
GACCGCGACGAGGTCAGGGCCGAGTACGAGCGCATCGTCTCGCGCCAACGCCGTCTCCAGGTGCAGAGGCGTGCC
GAGGAAGCGCAGAGGAACGGTCACAAGGAGGACGAGTCCTGA
Transcript >Hirsu2|4923
ATGGGCGGCCTCAACCTCGAGGTTTTCAAGTTCGGCATGTACGTCATGTTCCCGATCGGCATCATGTATTACTTC
GGTACCAACCTCGACGACCGATTCGCCGTCCGCAACTTCTGGCCCCGGCCCGAGGAGTGCAACAAGGTGCCCGGC
GACCGCGACGAGGTCAGGGCCGAGTACGAGCGCATCGTCTCGCGCCAACGCCGTCTCCAGGTGCAGAGGCGTGCC
GAGGAAGCGCAGAGGAACGGTCACAAGGAGGACGAGTCCTGA
Gene >Hirsu2|4923
ATGGGCGGCCTCAACCTCGAGGTTTTCAAGGTGTGCGCGCCTGTCTGTTTGAGGAGCGAAGCGTGCAGACGACGA
CGACGAGGCATTTGCTGACGGCGGCGACGGCGTACGCAGTTCGGCATGTACGTCATGTTCCCGATCGGCATCATG
TATTACTTCGGTACCAACCTCGACGACCGATTCGCCGTCCGCAACTTCTGGCCCCGGCCCGAGGAGTGCAACAAG
GTGCCCGGCGACCGCGACGAGGTCAGGGCCGAGTACGAGCGCATCGTCTCGCGCCAACGCCGTCTCCAGGTGCAG
AGGCGTGCCGAGGAAGCGCAGAGGAACGGTCACAAGGAGGACGAGTCCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail