Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4921
Gene name
LocationContig_2479:2292..2493
Strand-
Gene length (bp)201
Transcript length (bp)201
Coding sequence length (bp)201
Protein length (aa) 67

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05199 GMC_oxred_C GMC oxidoreductase 1.7E-14 1 49

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P81156|GOX_PENAG Glucose oxidase OS=Penicillium amagasakiense PE=1 SV=1 1 54 3.0E-09
sp|Q92452|GOX_TALFL Glucose oxidase OS=Talaromyces flavus GN=GOX PE=3 SV=1 1 54 3.0E-09
sp|P13006|GOX_ASPNG Glucose oxidase OS=Aspergillus niger GN=gox PE=1 SV=1 1 55 2.0E-08
sp|Q00593|ALKJ_PSEOL Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans GN=alkJ PE=1 SV=1 2 56 2.0E-07
sp|Q9VGP2|NINAG_DROME Neither inactivation nor afterpotential protein G OS=Drosophila melanogaster GN=ninaG PE=2 SV=2 6 55 3.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P81156|GOX_PENAG Glucose oxidase OS=Penicillium amagasakiense PE=1 SV=1 1 54 3.0E-09
sp|Q92452|GOX_TALFL Glucose oxidase OS=Talaromyces flavus GN=GOX PE=3 SV=1 1 54 3.0E-09
sp|P13006|GOX_ASPNG Glucose oxidase OS=Aspergillus niger GN=gox PE=1 SV=1 1 55 2.0E-08
sp|Q00593|ALKJ_PSEOL Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans GN=alkJ PE=1 SV=1 2 56 2.0E-07
sp|Q9VGP2|NINAG_DROME Neither inactivation nor afterpotential protein G OS=Drosophila melanogaster GN=ninaG PE=2 SV=2 6 55 3.0E-07
sp|Q9WWW2|ALKJ_PSEPU Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida GN=alkJ PE=3 SV=1 2 55 1.0E-06
sp|Q3L1D1|PDH1_AGABI Pyranose dehydrogenase OS=Agaricus bisporus GN=pdh1 PE=1 SV=1 8 55 5.0E-06
sp|Q6FDF9|BETA_ACIAD Oxygen-dependent choline dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=betA PE=3 SV=1 2 64 7.0E-06
sp|Q0R4L2|PDH3_LEUMG Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris GN=pdh3 PE=2 SV=1 8 55 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors Yes
GO:0055114 oxidation-reduction process Yes
GO:0016491 oxidoreductase activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4921
MMARELGGVVDPALAVYGAARLRVVDASVLPLQFSGHPTATLYAVAERAAELILRHGPAPVADAAS*
Coding >Hirsu2|4921
ATGATGGCGCGCGAGCTGGGCGGCGTCGTCGACCCGGCCCTGGCCGTCTACGGCGCGGCGCGGCTGCGCGTCGTC
GACGCCTCGGTCCTGCCGCTGCAGTTCAGCGGCCACCCGACCGCCACGCTGTACGCCGTCGCCGAGCGGGCGGCC
GAGCTGATTCTCCGGCACGGGCCGGCGCCGGTGGCGGACGCGGCCTCGTGA
Transcript >Hirsu2|4921
ATGATGGCGCGCGAGCTGGGCGGCGTCGTCGACCCGGCCCTGGCCGTCTACGGCGCGGCGCGGCTGCGCGTCGTC
GACGCCTCGGTCCTGCCGCTGCAGTTCAGCGGCCACCCGACCGCCACGCTGTACGCCGTCGCCGAGCGGGCGGCC
GAGCTGATTCTCCGGCACGGGCCGGCGCCGGTGGCGGACGCGGCCTCGTGA
Gene >Hirsu2|4921
ATGATGGCGCGCGAGCTGGGCGGCGTCGTCGACCCGGCCCTGGCCGTCTACGGCGCGGCGCGGCTGCGCGTCGTC
GACGCCTCGGTCCTGCCGCTGCAGTTCAGCGGCCACCCGACCGCCACGCTGTACGCCGTCGCCGAGCGGGCGGCC
GAGCTGATTCTCCGGCACGGGCCGGCGCCGGTGGCGGACGCGGCCTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail