Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|492
Gene name
LocationContig_11:1191..2474
Strand-
Gene length (bp)1283
Transcript length (bp)1143
Coding sequence length (bp)1143
Protein length (aa) 381

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01569 PAP2 PAP2 superfamily 7.4E-22 125 281

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8MXL9|Y5547_DICDI PA-phosphatase related-family protein DDB_G0275547 OS=Dictyostelium discoideum GN=DDB_G0275547 PE=3 SV=2 10 295 4.0E-25
sp|Q8LFD1|LPP3_ARATH Putative lipid phosphate phosphatase 3, chloroplastic OS=Arabidopsis thaliana GN=LPP3 PE=2 SV=1 70 276 2.0E-24
sp|Q9XI60|LPP2_ARATH Lipid phosphate phosphatase 2 OS=Arabidopsis thaliana GN=LPP2 PE=2 SV=1 70 297 3.0E-22
sp|Q9ZU49|LPP1_ARATH Lipid phosphate phosphatase 1 OS=Arabidopsis thaliana GN=LPP1 PE=2 SV=2 70 334 4.0E-22
sp|Q6GQ62|PLPP5_XENLA Phospholipid phosphatase 5 OS=Xenopus laevis GN=plpp5 PE=2 SV=1 94 295 4.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8MXL9|Y5547_DICDI PA-phosphatase related-family protein DDB_G0275547 OS=Dictyostelium discoideum GN=DDB_G0275547 PE=3 SV=2 10 295 4.0E-25
sp|Q8LFD1|LPP3_ARATH Putative lipid phosphate phosphatase 3, chloroplastic OS=Arabidopsis thaliana GN=LPP3 PE=2 SV=1 70 276 2.0E-24
sp|Q9XI60|LPP2_ARATH Lipid phosphate phosphatase 2 OS=Arabidopsis thaliana GN=LPP2 PE=2 SV=1 70 297 3.0E-22
sp|Q9ZU49|LPP1_ARATH Lipid phosphate phosphatase 1 OS=Arabidopsis thaliana GN=LPP1 PE=2 SV=2 70 334 4.0E-22
sp|Q6GQ62|PLPP5_XENLA Phospholipid phosphatase 5 OS=Xenopus laevis GN=plpp5 PE=2 SV=1 94 295 4.0E-22
sp|Q05521|DPP1_YEAST Diacylglycerol pyrophosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPP1 PE=1 SV=1 118 285 7.0E-22
sp|Q86AF0|Y7151_DICDI PA-phosphatase related-family protein DDB_G0271516 OS=Dictyostelium discoideum GN=DDB_G0271516 PE=3 SV=1 10 294 3.0E-21
sp|Q3UMZ3|PLPP5_MOUSE Phospholipid phosphatase 5 OS=Mus musculus GN=Plpp5 PE=2 SV=1 93 300 3.0E-20
sp|Q8NEB5|PLPP5_HUMAN Phospholipid phosphatase 5 OS=Homo sapiens GN=PLPP5 PE=1 SV=2 93 285 2.0E-18
sp|Q54PR7|Y4367_DICDI PA-phosphatase related-family protein DDB_G0284367 OS=Dictyostelium discoideum GN=DDB_G0284367 PE=3 SV=1 33 284 2.0E-17
sp|Q5VZY2|PLPP4_HUMAN Phospholipid phosphatase 4 OS=Homo sapiens GN=PLPP4 PE=1 SV=2 44 283 8.0E-17
sp|Q0VBU9|PLPP4_MOUSE Phospholipid phosphatase 4 OS=Mus musculus GN=Plpp4 PE=2 SV=1 44 283 9.0E-17
sp|Q0WNG6|LPP4_ARATH Probable lipid phosphate phosphatase 4 OS=Arabidopsis thaliana GN=LPP4 PE=2 SV=1 76 285 9.0E-17
sp|Q9UUA6|DPP1_SCHPO Probable diacylglycerol pyrophosphate phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpp1 PE=3 SV=1 31 283 2.0E-15
sp|Q04396|LPP1_YEAST Lipid phosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LPP1 PE=1 SV=1 137 303 3.0E-15
sp|Q9V576|WUN_DROME Putative phosphatidate phosphatase OS=Drosophila melanogaster GN=wun PE=1 SV=2 128 274 3.0E-10
sp|Q61469|PLPP1_MOUSE Phospholipid phosphatase 1 OS=Mus musculus GN=Plpp1 PE=1 SV=1 37 273 1.0E-08
sp|O08564|PLPP1_RAT Phospholipid phosphatase 1 OS=Rattus norvegicus GN=Plpp1 PE=1 SV=1 136 273 8.0E-08
sp|O14494|PLPP1_HUMAN Phospholipid phosphatase 1 OS=Homo sapiens GN=PLPP1 PE=1 SV=1 136 273 1.0E-07
sp|O88956|PLPP1_CAVPO Phospholipid phosphatase 1 OS=Cavia porcellus GN=PLPP1 PE=2 SV=1 37 273 2.0E-07
sp|Q10022|YSX3_CAEEL Uncharacterized protein T28D9.3 OS=Caenorhabditis elegans GN=T28D9.3 PE=1 SV=1 134 340 3.0E-07
sp|Q8K593|PLPP2_RAT Phospholipid phosphatase 2 OS=Rattus norvegicus GN=Plpp2 PE=2 SV=1 138 272 5.0E-07
sp|Q9DAX2|PLPP2_MOUSE Phospholipid phosphatase 2 OS=Mus musculus GN=Plpp2 PE=1 SV=1 138 277 5.0E-07
sp|O43688|PLPP2_HUMAN Phospholipid phosphatase 2 OS=Homo sapiens GN=PLPP2 PE=1 SV=1 138 272 2.0E-06
sp|Q2HJ61|PLPP2_BOVIN Phospholipid phosphatase 2 OS=Bos taurus GN=PLPP2 PE=2 SV=1 138 277 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.5

Transmembrane Domains

Domain # Start End Length
1 42 64 22
2 84 106 22
3 127 149 22
4 193 215 22
5 228 247 19
6 262 284 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|492
MASSSTPGPPAAASLAMGRRSAVKAFLVEWIKLNWADCVCMAAVGGVAYGVFVSPVPVTRTFPITFDGSGDIVYP
ELAYPFRGWIIAPWASGTLSILGPIVVYLAAQVRMRSAWEASAAMMGSAQAVLLASVFQVVLKQLIGGLRPYFLD
VCMPDVSRAAGHNATGLNGVGYGRLMYTTDVCTQPDAQRLQAAVTSFPSGHSTATFAGFGFLFLWMNAKLKVWAD
HRPAFWKLALTMLPLLLASLIACSLTVDAAHNWYDILAGSLIGLVMALASYRATYAALWDWRFNHMPLRQAEPFP
YAAPDAACPARTLTQSAGWGDTSAWLAHRLDSATSSAVFAQRRGGAAAEMTPRPADGGLDHPQQQSGRSKRHPLR
EGEAV*
Coding >Hirsu2|492
ATGGCTTCCTCGTCGACGCCCGGGCCGCCCGCTGCCGCGTCTCTGGCGATGGGCCGGCGGTCGGCCGTCAAGGCG
TTCCTGGTGGAGTGGATCAAGCTCAACTGGGCCGACTGCGTGTGCATGGCGGCCGTGGGCGGCGTCGCCTATGGC
GTCTTCGTGTCACCGGTGCCGGTGACGAGGACGTTCCCCATCACCTTCGATGGCTCGGGCGACATCGTCTACCCG
GAGCTGGCCTACCCCTTCCGCGGCTGGATCATCGCGCCCTGGGCGTCGGGCACGCTGTCGATCCTGGGCCCCATC
GTCGTCTACCTGGCGGCGCAGGTGCGGATGCGGTCGGCGTGGGAGGCCAGCGCGGCCATGATGGGCTCGGCCCAG
GCCGTCCTGCTGGCCTCGGTCTTCCAGGTGGTGCTGAAGCAGCTGATCGGGGGGCTGCGGCCGTACTTCCTCGAC
GTCTGCATGCCCGACGTGTCGCGCGCCGCCGGCCACAACGCGACGGGCCTCAACGGCGTCGGCTACGGCCGCCTC
ATGTACACGACCGACGTCTGCACCCAGCCCGACGCCCAGCGGCTGCAGGCGGCCGTCACGTCCTTCCCCAGCGGC
CACTCGACCGCCACCTTTGCCGGCTTCGGCTTCCTCTTCCTCTGGATGAACGCCAAGCTCAAGGTCTGGGCCGAC
CACCGGCCGGCCTTTTGGAAGCTGGCCCTGACGATGCTGCCGCTGCTGCTGGCCTCGCTCATCGCCTGCTCCCTG
ACCGTCGACGCCGCCCACAACTGGTACGACATCCTGGCCGGCTCCCTCATCGGCCTCGTCATGGCCCTGGCCTCG
TACCGCGCCACCTACGCCGCCCTCTGGGACTGGCGCTTCAACCACATGCCGCTGCGCCAGGCCGAGCCCTTCCCC
TACGCCGCCCCGGACGCCGCCTGCCCGGCCCGCACCCTCACCCAGAGCGCCGGATGGGGCGACACCAGCGCCTGG
CTGGCCCACCGCCTCGACAGCGCCACCAGCAGCGCCGTCTTTGCCCAGCGCCGGGGGGGCGCCGCCGCCGAGATG
ACGCCCAGGCCCGCCGACGGCGGCCTCGACCATCCGCAGCAGCAGAGCGGGAGGTCCAAGAGGCACCCGCTGAGG
GAGGGCGAGGCCGTCTGA
Transcript >Hirsu2|492
ATGGCTTCCTCGTCGACGCCCGGGCCGCCCGCTGCCGCGTCTCTGGCGATGGGCCGGCGGTCGGCCGTCAAGGCG
TTCCTGGTGGAGTGGATCAAGCTCAACTGGGCCGACTGCGTGTGCATGGCGGCCGTGGGCGGCGTCGCCTATGGC
GTCTTCGTGTCACCGGTGCCGGTGACGAGGACGTTCCCCATCACCTTCGATGGCTCGGGCGACATCGTCTACCCG
GAGCTGGCCTACCCCTTCCGCGGCTGGATCATCGCGCCCTGGGCGTCGGGCACGCTGTCGATCCTGGGCCCCATC
GTCGTCTACCTGGCGGCGCAGGTGCGGATGCGGTCGGCGTGGGAGGCCAGCGCGGCCATGATGGGCTCGGCCCAG
GCCGTCCTGCTGGCCTCGGTCTTCCAGGTGGTGCTGAAGCAGCTGATCGGGGGGCTGCGGCCGTACTTCCTCGAC
GTCTGCATGCCCGACGTGTCGCGCGCCGCCGGCCACAACGCGACGGGCCTCAACGGCGTCGGCTACGGCCGCCTC
ATGTACACGACCGACGTCTGCACCCAGCCCGACGCCCAGCGGCTGCAGGCGGCCGTCACGTCCTTCCCCAGCGGC
CACTCGACCGCCACCTTTGCCGGCTTCGGCTTCCTCTTCCTCTGGATGAACGCCAAGCTCAAGGTCTGGGCCGAC
CACCGGCCGGCCTTTTGGAAGCTGGCCCTGACGATGCTGCCGCTGCTGCTGGCCTCGCTCATCGCCTGCTCCCTG
ACCGTCGACGCCGCCCACAACTGGTACGACATCCTGGCCGGCTCCCTCATCGGCCTCGTCATGGCCCTGGCCTCG
TACCGCGCCACCTACGCCGCCCTCTGGGACTGGCGCTTCAACCACATGCCGCTGCGCCAGGCCGAGCCCTTCCCC
TACGCCGCCCCGGACGCCGCCTGCCCGGCCCGCACCCTCACCCAGAGCGCCGGATGGGGCGACACCAGCGCCTGG
CTGGCCCACCGCCTCGACAGCGCCACCAGCAGCGCCGTCTTTGCCCAGCGCCGGGGGGGCGCCGCCGCCGAGATG
ACGCCCAGGCCCGCCGACGGCGGCCTCGACCATCCGCAGCAGCAGAGCGGGAGGTCCAAGAGGCACCCGCTGAGG
GAGGGCGAGGCCGTCTGA
Gene >Hirsu2|492
ATGGCTTCCTCGTCGACGCCCGGGCCGCCCGCTGCCGCGTCTCTGGCGATGGGCCGGCGGTCGGCCGTCAAGGCG
TTCCTGGTGGAGTGGATCAAGCTCAACTGGGCCGACTGCGTGTGCATGGCGGCCGTGGGCGGCGTCGCCTATGGC
GTTTGTCTCCCCCCTCTTTGTTCCCCTCGTCGTGTGTGCGGCCCGGTGTTGCTGCTGCTTGCTCGCTCGGCCCAG
GCGTCGTCGTCATCGTTCTTCTTGTTGTTGTCCGGCTGCTGACCCGGCGTCATGGCCACGACTAGGTCTTCGTGT
CACCGGTGCCGGTGACGAGGACGTTCCCCATCACCTTCGATGGCTCGGGCGACATCGTCTACCCGGAGCTGGCCT
ACCCCTTCCGCGGCTGGATCATCGCGCCCTGGGCGTCGGGCACGCTGTCGATCCTGGGCCCCATCGTCGTCTACC
TGGCGGCGCAGGTGCGGATGCGGTCGGCGTGGGAGGCCAGCGCGGCCATGATGGGCTCGGCCCAGGCCGTCCTGC
TGGCCTCGGTCTTCCAGGTGGTGCTGAAGCAGCTGATCGGGGGGCTGCGGCCGTACTTCCTCGACGTCTGCATGC
CCGACGTGTCGCGCGCCGCCGGCCACAACGCGACGGGCCTCAACGGCGTCGGCTACGGCCGCCTCATGTACACGA
CCGACGTCTGCACCCAGCCCGACGCCCAGCGGCTGCAGGCGGCCGTCACGTCCTTCCCCAGCGGCCACTCGACCG
CCACCTTTGCCGGCTTCGGCTTCCTCTTCCTCTGGATGAACGCCAAGCTCAAGGTCTGGGCCGACCACCGGCCGG
CCTTTTGGAAGCTGGCCCTGACGATGCTGCCGCTGCTGCTGGCCTCGCTCATCGCCTGCTCCCTGACCGTCGACG
CCGCCCACAACTGGTACGACATCCTGGCCGGCTCCCTCATCGGCCTCGTCATGGCCCTGGCCTCGTACCGCGCCA
CCTACGCCGCCCTCTGGGACTGGCGCTTCAACCACATGCCGCTGCGCCAGGCCGAGCCCTTCCCCTACGCCGCCC
CGGACGCCGCCTGCCCGGCCCGCACCCTCACCCAGAGCGCCGGATGGGGCGACACCAGCGCCTGGCTGGCCCACC
GCCTCGACAGCGCCACCAGCAGCGCCGTCTTTGCCCAGCGCCGGGGGGGCGCCGCCGCCGAGATGACGCCCAGGC
CCGCCGACGGCGGCCTCGACCATCCGCAGCAGCAGAGCGGGAGGTCCAAGAGGCACCCGCTGAGGGAGGGCGAGG
CCGTCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail