Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4916
Gene name
LocationContig_2474:845..2378
Strand-
Gene length (bp)1533
Transcript length (bp)1533
Coding sequence length (bp)1533
Protein length (aa) 511

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04646 DUF604 Protein of unknown function, DUF604 4.0E-06 284 367
PF02434 Fringe Fringe-like 1.2E-06 228 329

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0016757 glycosyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 7 25 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4916
MRRRKRLTLLSLSAVLAFVLLGAVLRSRIVSSPATTSEDRFATARTSCALDASRLAEIKQRYDVDGRFDYLSRTI
RFRRTQGLGRKTMTVLPQALFAAANTLTVDVDGELDAAAVEGASSEPLQVEVPVSGLPSTVDASDFMFGISTTYQ
RLSESRADIVSDWQYWLTDGRGVSNGAKLFLTLLEASDEQLRDARALLRDAGIDASVDRSDDRDMPVRYLNLVPH
LYRQEAARRRRWLVLCDDDTFFPSMHGLARRLASFDHARELYIGTLSEDVGAVERHGSQAFGGAGVFLSLPMARR
ISESIGRCASRDKVEAAGWQGDKLLRNCIYENSDTRLVLLPDLWQLDFRGDAAGFYEWGRKPLSLHHYRGGGWHT
ARPAQFSKIAYACGEDCILQRFQTADHFILAGHSVAHYPAGVTFDTSQVERTFEPLHETSWNFDFVFGPQRPPLK
KSGHKISWEIQRSELRPDGSVLQTYLRKKDHVRWQGADNRQMGELDSIIELVWQPSEATA*
Coding >Hirsu2|4916
ATGCGTCGTCGCAAGAGGCTGACGCTGCTCTCCCTGTCCGCTGTGCTTGCCTTCGTCCTGCTGGGCGCCGTGCTG
CGGAGCCGGATAGTGTCGAGTCCTGCGACGACGTCCGAGGACAGGTTTGCGACGGCACGGACATCCTGCGCCCTC
GACGCTTCCCGTCTCGCCGAAATCAAGCAAAGATACGATGTCGACGGCCGGTTCGACTACCTCAGCCGGACTATC
CGCTTCCGGCGCACCCAGGGCCTGGGCCGGAAGACCATGACGGTCCTGCCACAGGCCTTGTTCGCCGCCGCCAAC
ACGCTCACCGTCGATGTCGACGGGGAACTCGACGCCGCCGCCGTCGAGGGCGCCAGCTCCGAGCCCCTGCAGGTC
GAGGTGCCCGTGTCCGGCCTCCCGTCGACGGTGGACGCGTCCGACTTCATGTTCGGCATCTCGACGACGTATCAA
CGGCTGAGCGAATCGCGCGCCGACATCGTCTCCGACTGGCAATACTGGCTCACCGACGGCCGCGGCGTCAGCAAC
GGCGCCAAGCTGTTCCTGACGCTGCTCGAGGCCAGCGACGAGCAGCTGCGCGACGCGCGCGCGCTTCTCCGCGAC
GCCGGCATCGACGCCAGCGTCGACCGCTCCGACGACCGCGACATGCCGGTCCGCTACCTCAACCTCGTCCCGCAC
CTGTACCGCCAGGAGGCCGCCCGGCGCCGGCGGTGGCTGGTGCTGTGCGACGACGACACCTTCTTCCCGAGCATG
CACGGGCTCGCGCGGCGGCTGGCCTCGTTCGACCACGCGCGCGAGCTCTACATCGGCACCCTCTCCGAGGACGTC
GGCGCCGTCGAGCGGCACGGCTCGCAGGCCTTCGGCGGGGCCGGCGTCTTCCTGTCGCTGCCGATGGCCCGGCGC
ATCAGCGAGTCCATCGGCCGCTGCGCCTCCAGGGACAAGGTCGAGGCCGCCGGCTGGCAGGGCGACAAGCTGCTG
CGCAACTGCATCTACGAAAACAGCGACACCCGCCTCGTCCTGCTGCCGGACCTGTGGCAGCTCGACTTCCGCGGC
GACGCCGCCGGCTTCTACGAATGGGGCCGCAAGCCGCTCTCGCTGCACCACTACCGCGGCGGCGGCTGGCACACG
GCCCGGCCCGCCCAGTTCAGCAAGATCGCCTACGCCTGCGGCGAGGACTGCATCCTGCAGCGGTTCCAGACGGCC
GACCACTTCATCCTCGCCGGCCACTCCGTCGCCCACTACCCGGCCGGCGTCACCTTCGACACGAGCCAGGTCGAG
CGGACGTTTGAGCCGCTGCACGAGACGAGCTGGAACTTCGACTTCGTCTTCGGCCCCCAGCGCCCGCCGCTGAAG
AAGAGCGGCCACAAGATCTCGTGGGAGATCCAGCGGTCCGAGCTCCGCCCCGACGGCTCCGTCCTGCAGACGTAC
CTGAGGAAAAAGGACCATGTCCGCTGGCAGGGCGCGGATAATCGGCAGATGGGTGAGCTCGATAGCATAATCGAG
CTGGTCTGGCAGCCGTCAGAGGCCACTGCCTGA
Transcript >Hirsu2|4916
ATGCGTCGTCGCAAGAGGCTGACGCTGCTCTCCCTGTCCGCTGTGCTTGCCTTCGTCCTGCTGGGCGCCGTGCTG
CGGAGCCGGATAGTGTCGAGTCCTGCGACGACGTCCGAGGACAGGTTTGCGACGGCACGGACATCCTGCGCCCTC
GACGCTTCCCGTCTCGCCGAAATCAAGCAAAGATACGATGTCGACGGCCGGTTCGACTACCTCAGCCGGACTATC
CGCTTCCGGCGCACCCAGGGCCTGGGCCGGAAGACCATGACGGTCCTGCCACAGGCCTTGTTCGCCGCCGCCAAC
ACGCTCACCGTCGATGTCGACGGGGAACTCGACGCCGCCGCCGTCGAGGGCGCCAGCTCCGAGCCCCTGCAGGTC
GAGGTGCCCGTGTCCGGCCTCCCGTCGACGGTGGACGCGTCCGACTTCATGTTCGGCATCTCGACGACGTATCAA
CGGCTGAGCGAATCGCGCGCCGACATCGTCTCCGACTGGCAATACTGGCTCACCGACGGCCGCGGCGTCAGCAAC
GGCGCCAAGCTGTTCCTGACGCTGCTCGAGGCCAGCGACGAGCAGCTGCGCGACGCGCGCGCGCTTCTCCGCGAC
GCCGGCATCGACGCCAGCGTCGACCGCTCCGACGACCGCGACATGCCGGTCCGCTACCTCAACCTCGTCCCGCAC
CTGTACCGCCAGGAGGCCGCCCGGCGCCGGCGGTGGCTGGTGCTGTGCGACGACGACACCTTCTTCCCGAGCATG
CACGGGCTCGCGCGGCGGCTGGCCTCGTTCGACCACGCGCGCGAGCTCTACATCGGCACCCTCTCCGAGGACGTC
GGCGCCGTCGAGCGGCACGGCTCGCAGGCCTTCGGCGGGGCCGGCGTCTTCCTGTCGCTGCCGATGGCCCGGCGC
ATCAGCGAGTCCATCGGCCGCTGCGCCTCCAGGGACAAGGTCGAGGCCGCCGGCTGGCAGGGCGACAAGCTGCTG
CGCAACTGCATCTACGAAAACAGCGACACCCGCCTCGTCCTGCTGCCGGACCTGTGGCAGCTCGACTTCCGCGGC
GACGCCGCCGGCTTCTACGAATGGGGCCGCAAGCCGCTCTCGCTGCACCACTACCGCGGCGGCGGCTGGCACACG
GCCCGGCCCGCCCAGTTCAGCAAGATCGCCTACGCCTGCGGCGAGGACTGCATCCTGCAGCGGTTCCAGACGGCC
GACCACTTCATCCTCGCCGGCCACTCCGTCGCCCACTACCCGGCCGGCGTCACCTTCGACACGAGCCAGGTCGAG
CGGACGTTTGAGCCGCTGCACGAGACGAGCTGGAACTTCGACTTCGTCTTCGGCCCCCAGCGCCCGCCGCTGAAG
AAGAGCGGCCACAAGATCTCGTGGGAGATCCAGCGGTCCGAGCTCCGCCCCGACGGCTCCGTCCTGCAGACGTAC
CTGAGGAAAAAGGACCATGTCCGCTGGCAGGGCGCGGATAATCGGCAGATGGGTGAGCTCGATAGCATAATCGAG
CTGGTCTGGCAGCCGTCAGAGGCCACTGCCTGA
Gene >Hirsu2|4916
ATGCGTCGTCGCAAGAGGCTGACGCTGCTCTCCCTGTCCGCTGTGCTTGCCTTCGTCCTGCTGGGCGCCGTGCTG
CGGAGCCGGATAGTGTCGAGTCCTGCGACGACGTCCGAGGACAGGTTTGCGACGGCACGGACATCCTGCGCCCTC
GACGCTTCCCGTCTCGCCGAAATCAAGCAAAGATACGATGTCGACGGCCGGTTCGACTACCTCAGCCGGACTATC
CGCTTCCGGCGCACCCAGGGCCTGGGCCGGAAGACCATGACGGTCCTGCCACAGGCCTTGTTCGCCGCCGCCAAC
ACGCTCACCGTCGATGTCGACGGGGAACTCGACGCCGCCGCCGTCGAGGGCGCCAGCTCCGAGCCCCTGCAGGTC
GAGGTGCCCGTGTCCGGCCTCCCGTCGACGGTGGACGCGTCCGACTTCATGTTCGGCATCTCGACGACGTATCAA
CGGCTGAGCGAATCGCGCGCCGACATCGTCTCCGACTGGCAATACTGGCTCACCGACGGCCGCGGCGTCAGCAAC
GGCGCCAAGCTGTTCCTGACGCTGCTCGAGGCCAGCGACGAGCAGCTGCGCGACGCGCGCGCGCTTCTCCGCGAC
GCCGGCATCGACGCCAGCGTCGACCGCTCCGACGACCGCGACATGCCGGTCCGCTACCTCAACCTCGTCCCGCAC
CTGTACCGCCAGGAGGCCGCCCGGCGCCGGCGGTGGCTGGTGCTGTGCGACGACGACACCTTCTTCCCGAGCATG
CACGGGCTCGCGCGGCGGCTGGCCTCGTTCGACCACGCGCGCGAGCTCTACATCGGCACCCTCTCCGAGGACGTC
GGCGCCGTCGAGCGGCACGGCTCGCAGGCCTTCGGCGGGGCCGGCGTCTTCCTGTCGCTGCCGATGGCCCGGCGC
ATCAGCGAGTCCATCGGCCGCTGCGCCTCCAGGGACAAGGTCGAGGCCGCCGGCTGGCAGGGCGACAAGCTGCTG
CGCAACTGCATCTACGAAAACAGCGACACCCGCCTCGTCCTGCTGCCGGACCTGTGGCAGCTCGACTTCCGCGGC
GACGCCGCCGGCTTCTACGAATGGGGCCGCAAGCCGCTCTCGCTGCACCACTACCGCGGCGGCGGCTGGCACACG
GCCCGGCCCGCCCAGTTCAGCAAGATCGCCTACGCCTGCGGCGAGGACTGCATCCTGCAGCGGTTCCAGACGGCC
GACCACTTCATCCTCGCCGGCCACTCCGTCGCCCACTACCCGGCCGGCGTCACCTTCGACACGAGCCAGGTCGAG
CGGACGTTTGAGCCGCTGCACGAGACGAGCTGGAACTTCGACTTCGTCTTCGGCCCCCAGCGCCCGCCGCTGAAG
AAGAGCGGCCACAAGATCTCGTGGGAGATCCAGCGGTCCGAGCTCCGCCCCGACGGCTCCGTCCTGCAGACGTAC
CTGAGGAAAAAGGACCATGTCCGCTGGCAGGGCGCGGATAATCGGCAGATGGGTGAGCTCGATAGCATAATCGAG
CTGGTCTGGCAGCCGTCAGAGGCCACTGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail