Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4913
Gene name
LocationContig_2472:1392..2495
Strand+
Gene length (bp)1103
Transcript length (bp)972
Coding sequence length (bp)972
Protein length (aa) 324

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04670 Gtr1_RagA Gtr1/RagA G protein conserved region 1.6E-64 1 221

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74544|GTR2_SCHPO GTP-binding protein gtr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gtr2 PE=3 SV=1 1 322 7.0E-117
sp|Q99K70|RRAGC_MOUSE Ras-related GTP-binding protein C OS=Mus musculus GN=Rragc PE=1 SV=1 1 318 1.0E-98
sp|Q9HB90|RRAGC_HUMAN Ras-related GTP-binding protein C OS=Homo sapiens GN=RRAGC PE=1 SV=1 1 318 2.0E-98
sp|Q9NQL2|RRAGD_HUMAN Ras-related GTP-binding protein D OS=Homo sapiens GN=RRAGD PE=1 SV=1 1 318 1.0E-96
sp|Q7TT45|RRAGD_MOUSE Ras-related GTP-binding protein D OS=Mus musculus GN=Rragd PE=2 SV=2 1 318 2.0E-94
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74544|GTR2_SCHPO GTP-binding protein gtr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gtr2 PE=3 SV=1 1 322 7.0E-117
sp|Q99K70|RRAGC_MOUSE Ras-related GTP-binding protein C OS=Mus musculus GN=Rragc PE=1 SV=1 1 318 1.0E-98
sp|Q9HB90|RRAGC_HUMAN Ras-related GTP-binding protein C OS=Homo sapiens GN=RRAGC PE=1 SV=1 1 318 2.0E-98
sp|Q9NQL2|RRAGD_HUMAN Ras-related GTP-binding protein D OS=Homo sapiens GN=RRAGD PE=1 SV=1 1 318 1.0E-96
sp|Q7TT45|RRAGD_MOUSE Ras-related GTP-binding protein D OS=Mus musculus GN=Rragd PE=2 SV=2 1 318 2.0E-94
sp|P53290|GTR2_YEAST GTP-binding protein GTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GTR2 PE=1 SV=1 1 316 5.0E-78
sp|Q54IK1|RRAGA_DICDI Ras-related GTP-binding protein A OS=Dictyostelium discoideum GN=ragA PE=2 SV=1 1 195 1.0E-13
sp|O74824|GTR1_SCHPO GTP-binding protein gtr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gtr1 PE=3 SV=1 1 213 8.0E-11
sp|Q63486|RRAGA_RAT Ras-related GTP-binding protein A OS=Rattus norvegicus GN=Rraga PE=1 SV=1 1 195 3.0E-10
sp|Q80X95|RRAGA_MOUSE Ras-related GTP-binding protein A OS=Mus musculus GN=Rraga PE=1 SV=1 1 195 3.0E-10
sp|Q7L523|RRAGA_HUMAN Ras-related GTP-binding protein A OS=Homo sapiens GN=RRAGA PE=1 SV=1 1 195 3.0E-10
sp|Q3SX43|RRAGA_BOVIN Ras-related GTP-binding protein A OS=Bos taurus GN=RRAGA PE=2 SV=1 1 195 3.0E-10
sp|Q00582|GTR1_YEAST GTP-binding protein GTR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GTR1 PE=1 SV=1 1 226 3.0E-10
sp|Q5VZM2|RRAGB_HUMAN Ras-related GTP-binding protein B OS=Homo sapiens GN=RRAGB PE=1 SV=1 1 195 3.0E-07
sp|Q63487|RRAGB_RAT Ras-related GTP-binding protein B OS=Rattus norvegicus GN=RragB PE=1 SV=1 1 195 3.0E-07
sp|Q6NTA4|RRAGB_MOUSE Ras-related GTP-binding protein B OS=Mus musculus GN=Rragb PE=2 SV=1 1 195 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0032550 purine ribonucleoside binding No
GO:0001883 purine nucleoside binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0032549 ribonucleoside binding No
GO:0097159 organic cyclic compound binding No
GO:0019001 guanyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0001882 nucleoside binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4913
MGQRRSGKSSIASVVFHKLPANETLFLESTARIQKDSMASFMDFSVWDFPGQIDVLDESLDLDAIFGEMGAVIWV
IDAQDDYLEAVARLNAVILALQGHYPNVNIEVFIHKVDGLSDDFKLDIQRDITIRIQDELSDNGFENAPVTFHLT
SIYNHSIFEAFSRVIQKLIPRLGTLESMLTNLCRTCRFEKAYLFDVLSKIYIATDSATADMASYEICSDYIDVII
DITEVYGTWQRSDKSKEKLGAEPWNAKLEDQIGCSTAESCLVLHDSNKPIMLREVDRYLALVAIMKDDSYDRMPL
VNMNVEAVVEGLTEFFDITKPRK*
Coding >Hirsu2|4913
ATGGGCCAGAGGCGAAGCGGCAAGTCATCCATTGCGAGCGTCGTCTTCCACAAGCTCCCCGCAAACGAGACCCTG
TTTCTCGAGTCCACCGCGCGGATACAAAAGGACTCCATGGCGTCTTTCATGGATTTCTCGGTATGGGACTTCCCT
GGCCAAATTGACGTGCTCGATGAATCCTTGGATCTAGACGCCATATTTGGCGAAATGGGGGCCGTCATATGGGTC
ATCGATGCTCAGGATGACTATCTGGAAGCCGTCGCTCGGCTCAACGCGGTCATCTTGGCCCTCCAGGGCCACTAT
CCCAACGTCAACATCGAAGTCTTCATCCACAAAGTCGACGGCCTCTCGGATGACTTCAAGCTAGACATCCAACGC
GACATAACCATCCGCATCCAGGACGAACTCTCGGACAATGGCTTCGAAAACGCCCCCGTCACATTCCACCTCACC
TCAATCTACAACCACTCCATCTTCGAGGCCTTCAGTCGCGTCATTCAGAAGCTAATACCCCGCCTCGGCACGCTC
GAATCCATGCTCACCAACCTGTGCCGCACGTGCCGCTTCGAGAAGGCCTACCTGTTTGACGTCCTGTCCAAGATC
TATATTGCAACGGACAGCGCCACCGCCGACATGGCCAGCTATGAGATCTGCAGCGACTACATCGACGTCATCATC
GACATCACAGAGGTCTACGGCACCTGGCAGCGCAGCGACAAGAGCAAGGAGAAGCTCGGGGCCGAGCCGTGGAAC
GCCAAGCTCGAGGACCAGATCGGCTGCTCGACGGCAGAGAGCTGCCTCGTGCTGCACGACAGTAACAAGCCCATC
ATGCTTCGCGAGGTGGACCGCTATCTTGCACTGGTGGCCATCATGAAGGACGACTCGTACGACAGAATGCCGCTC
GTCAACATGAATGTCGAGGCCGTCGTCGAGGGACTCACGGAGTTCTTCGACATAACCAAACCCAGGAAATGA
Transcript >Hirsu2|4913
ATGGGCCAGAGGCGAAGCGGCAAGTCATCCATTGCGAGCGTCGTCTTCCACAAGCTCCCCGCAAACGAGACCCTG
TTTCTCGAGTCCACCGCGCGGATACAAAAGGACTCCATGGCGTCTTTCATGGATTTCTCGGTATGGGACTTCCCT
GGCCAAATTGACGTGCTCGATGAATCCTTGGATCTAGACGCCATATTTGGCGAAATGGGGGCCGTCATATGGGTC
ATCGATGCTCAGGATGACTATCTGGAAGCCGTCGCTCGGCTCAACGCGGTCATCTTGGCCCTCCAGGGCCACTAT
CCCAACGTCAACATCGAAGTCTTCATCCACAAAGTCGACGGCCTCTCGGATGACTTCAAGCTAGACATCCAACGC
GACATAACCATCCGCATCCAGGACGAACTCTCGGACAATGGCTTCGAAAACGCCCCCGTCACATTCCACCTCACC
TCAATCTACAACCACTCCATCTTCGAGGCCTTCAGTCGCGTCATTCAGAAGCTAATACCCCGCCTCGGCACGCTC
GAATCCATGCTCACCAACCTGTGCCGCACGTGCCGCTTCGAGAAGGCCTACCTGTTTGACGTCCTGTCCAAGATC
TATATTGCAACGGACAGCGCCACCGCCGACATGGCCAGCTATGAGATCTGCAGCGACTACATCGACGTCATCATC
GACATCACAGAGGTCTACGGCACCTGGCAGCGCAGCGACAAGAGCAAGGAGAAGCTCGGGGCCGAGCCGTGGAAC
GCCAAGCTCGAGGACCAGATCGGCTGCTCGACGGCAGAGAGCTGCCTCGTGCTGCACGACAGTAACAAGCCCATC
ATGCTTCGCGAGGTGGACCGCTATCTTGCACTGGTGGCCATCATGAAGGACGACTCGTACGACAGAATGCCGCTC
GTCAACATGAATGTCGAGGCCGTCGTCGAGGGACTCACGGAGTTCTTCGACATAACCAAACCCAGGAAATGA
Gene >Hirsu2|4913
ATGGGCCAGAGGCGGTAGGTTGGCGCGATCCCAGACCCAGATTCGGCAGTCGCATCGGCTGACAGACATTTCCAG
AAGCGGCAAGTCATCCATTGCGAGCGTCGTCTTCCACAAGCTCCCCGCAAACGAGACCCTGTTTCTCGAGTCCAC
CGCGCGGATACAAAAGGACTCCATGGCGTGGGTTTTTTTCCCGGCCCGGCTCCCGCTTGCTTCTGTCTATGTCGT
CTCATAACTGAAACGCTGGTAGGTCTTTCATGGATTTCTCGGTATGGGACTTCCCTGGCCAAATTGACGTGCTCG
ATGAATCCTTGGATCTAGACGCCATATTTGGCGAAATGGGGGCCGTCATATGGGTCATCGATGCTCAGGATGACT
ATCTGGAAGCCGTCGCTCGGCTCAACGCGGTCATCTTGGCCCTCCAGGGCCACTATCCCAACGTCAACATCGAAG
TCTTCATCCACAAAGTCGACGGCCTCTCGGATGACTTCAAGCTAGACATCCAACGCGACATAACCATCCGCATCC
AGGACGAACTCTCGGACAATGGCTTCGAAAACGCCCCCGTCACATTCCACCTCACCTCAATCTACAACCACTCCA
TCTTCGAGGCCTTCAGTCGCGTCATTCAGAAGCTAATACCCCGCCTCGGCACGCTCGAATCCATGCTCACCAACC
TGTGCCGCACGTGCCGCTTCGAGAAGGCCTACCTGTTTGACGTCCTGTCCAAGATCTATATTGCAACGGACAGCG
CCACCGCCGACATGGCCAGCTATGAGATCTGCAGCGACTACATCGACGTCATCATCGACATCACAGAGGTCTACG
GCACCTGGCAGCGCAGCGACAAGAGCAAGGAGAAGCTCGGGGCCGAGCCGTGGAACGCCAAGCTCGAGGACCAGA
TCGGCTGCTCGACGGCAGAGAGCTGCCTCGTGCTGCACGACAGTAACAAGCCCATCATGCTTCGCGAGGTGGACC
GCTATCTTGCACTGGTGGCCATCATGAAGGACGACTCGTACGACAGAATGCCGCTCGTCAACATGAATGTCGAGG
CCGTCGTCGAGGGACTCACGGAGTTCTTCGACATAACCAAACCCAGGAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail