Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|490
Gene name
LocationContig_1099:6425..7715
Strand+
Gene length (bp)1290
Transcript length (bp)1092
Coding sequence length (bp)1092
Protein length (aa) 364

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04695 Pex14_N Peroxisomal membrane anchor protein (Pex14p) conserved region 3.4E-32 4 116

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78723|PEX14_PICAN Peroxisomal membrane protein PER10 OS=Pichia angusta GN=PEX14 PE=3 SV=1 4 333 3.0E-39
sp|Q9HG09|PEX14_PICPA Peroxisomal membrane protein PEX14 OS=Komagataella pastoris GN=PEX14 PE=1 SV=1 2 264 2.0E-35
sp|P53112|PEX14_YEAST Peroxisomal membrane protein PEX14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX14 PE=1 SV=1 4 330 4.0E-30
sp|O60065|PEX14_SCHPO Peroxisomal membrane protein pex14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pex14 PE=3 SV=1 3 231 6.0E-28
sp|Q642G4|PEX14_RAT Peroxisomal membrane protein PEX14 OS=Rattus norvegicus GN=Pex14 PE=1 SV=1 4 244 8.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78723|PEX14_PICAN Peroxisomal membrane protein PER10 OS=Pichia angusta GN=PEX14 PE=3 SV=1 4 333 3.0E-39
sp|Q9HG09|PEX14_PICPA Peroxisomal membrane protein PEX14 OS=Komagataella pastoris GN=PEX14 PE=1 SV=1 2 264 2.0E-35
sp|P53112|PEX14_YEAST Peroxisomal membrane protein PEX14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX14 PE=1 SV=1 4 330 4.0E-30
sp|O60065|PEX14_SCHPO Peroxisomal membrane protein pex14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pex14 PE=3 SV=1 3 231 6.0E-28
sp|Q642G4|PEX14_RAT Peroxisomal membrane protein PEX14 OS=Rattus norvegicus GN=Pex14 PE=1 SV=1 4 244 8.0E-19
sp|Q9R0A0|PEX14_MOUSE Peroxisomal membrane protein PEX14 OS=Mus musculus GN=Pex14 PE=1 SV=1 4 244 9.0E-19
sp|O75381|PEX14_HUMAN Peroxisomal membrane protein PEX14 OS=Homo sapiens GN=PEX14 PE=1 SV=1 4 124 2.0E-15
sp|Q9Z2Z3|PEX14_CRILO Peroxisomal membrane protein PEX14 OS=Cricetulus longicaudatus GN=PEX14 PE=2 SV=1 4 244 3.0E-15
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|490
MAVREDLVVSAAQFLQDPSVASSSVENKISFLRSKNLTQEEIDAALARTGPSPPTAAPPAGPPQPYYPPYPPNAW
QQTPPYPPPRRDWRDWFIMATVVGGVGYGLYTLGKRYVFPLVAPPTPDRLAQDKKSIEEQFDRAFVLVEQLAKDT
EALKRAEQQRTERLDTALVELERTVTDLKSANRRREDDAQRIRDEVQSLKDAIPQAMSSQKDVTDNRLSEINSEL
ASLKTLVSQRMASASASAPGHALRAGMSSGSGSGSGSGSGSGSAGASGNGSGSDKAGEGFANATTTETSSKSAAQ
NSVGRPLGFGSTNGGGRASIPAWQMAAAANSNGTDDKGAPAATVNGAGEGEGQTQQAEASSSS*
Coding >Hirsu2|490
ATGGCTGTCCGCGAGGACCTGGTGGTCTCTGCAGCGCAGTTCCTGCAGGACCCCAGCGTTGCCTCGTCGTCGGTC
GAGAACAAGATCTCCTTTCTGCGAAGCAAGAACCTGACGCAGGAGGAGATCGACGCTGCCCTCGCCCGAACCGGG
CCGTCGCCTCCCACCGCAGCGCCACCTGCCGGCCCTCCGCAGCCGTACTATCCACCCTATCCTCCGAATGCGTGG
CAGCAGACGCCTCCGTACCCTCCGCCGAGGCGGGACTGGCGAGACTGGTTCATAATGGCGACTGTCGTCGGCGGC
GTGGGATACGGCCTGTACACGCTTGGAAAGCGCTACGTTTTCCCGCTGGTGGCGCCGCCGACTCCGGATAGGCTG
GCGCAGGACAAGAAATCGATCGAGGAGCAGTTCGACCGGGCGTTTGTGCTGGTGGAGCAGCTGGCCAAGGACACG
GAGGCGCTCAAAAGGGCAGAGCAGCAGAGGACGGAGAGACTGGACACGGCGCTGGTGGAGCTCGAGCGGACGGTG
ACTGACCTGAAATCGGCGAACCGACGTCGCGAGGACGACGCGCAGCGGATCCGCGACGAAGTACAGTCTCTCAAA
GACGCGATCCCGCAAGCGATGAGCAGCCAGAAAGATGTGACGGACAATCGGCTGTCGGAAATCAACAGCGAGCTC
GCCAGCCTCAAGACGCTGGTCTCGCAGCGCATGGCGTCGGCGTCGGCGTCGGCGCCCGGCCACGCTCTACGAGCC
GGCATGTCCAGCGGCAGCGGCAGCGGCAGCGGCAGCGGCAGCGGCAGCGGCAGCGCAGGTGCAAGCGGAAACGGG
AGCGGCAGCGACAAGGCCGGGGAGGGGTTCGCCAACGCAACAACGACCGAGACGTCGAGCAAGAGTGCGGCACAA
AACAGCGTCGGCAGACCGCTGGGCTTCGGCAGCACCAACGGCGGCGGCAGAGCATCGATCCCGGCGTGGCAGATG
GCGGCGGCGGCCAACAGCAACGGGACGGACGACAAGGGCGCCCCGGCCGCTACCGTCAACGGGGCCGGAGAGGGA
GAGGGCCAGACGCAACAGGCAGAGGCCAGCAGCAGCTCGTAG
Transcript >Hirsu2|490
ATGGCTGTCCGCGAGGACCTGGTGGTCTCTGCAGCGCAGTTCCTGCAGGACCCCAGCGTTGCCTCGTCGTCGGTC
GAGAACAAGATCTCCTTTCTGCGAAGCAAGAACCTGACGCAGGAGGAGATCGACGCTGCCCTCGCCCGAACCGGG
CCGTCGCCTCCCACCGCAGCGCCACCTGCCGGCCCTCCGCAGCCGTACTATCCACCCTATCCTCCGAATGCGTGG
CAGCAGACGCCTCCGTACCCTCCGCCGAGGCGGGACTGGCGAGACTGGTTCATAATGGCGACTGTCGTCGGCGGC
GTGGGATACGGCCTGTACACGCTTGGAAAGCGCTACGTTTTCCCGCTGGTGGCGCCGCCGACTCCGGATAGGCTG
GCGCAGGACAAGAAATCGATCGAGGAGCAGTTCGACCGGGCGTTTGTGCTGGTGGAGCAGCTGGCCAAGGACACG
GAGGCGCTCAAAAGGGCAGAGCAGCAGAGGACGGAGAGACTGGACACGGCGCTGGTGGAGCTCGAGCGGACGGTG
ACTGACCTGAAATCGGCGAACCGACGTCGCGAGGACGACGCGCAGCGGATCCGCGACGAAGTACAGTCTCTCAAA
GACGCGATCCCGCAAGCGATGAGCAGCCAGAAAGATGTGACGGACAATCGGCTGTCGGAAATCAACAGCGAGCTC
GCCAGCCTCAAGACGCTGGTCTCGCAGCGCATGGCGTCGGCGTCGGCGTCGGCGCCCGGCCACGCTCTACGAGCC
GGCATGTCCAGCGGCAGCGGCAGCGGCAGCGGCAGCGGCAGCGGCAGCGGCAGCGCAGGTGCAAGCGGAAACGGG
AGCGGCAGCGACAAGGCCGGGGAGGGGTTCGCCAACGCAACAACGACCGAGACGTCGAGCAAGAGTGCGGCACAA
AACAGCGTCGGCAGACCGCTGGGCTTCGGCAGCACCAACGGCGGCGGCAGAGCATCGATCCCGGCGTGGCAGATG
GCGGCGGCGGCCAACAGCAACGGGACGGACGACAAGGGCGCCCCGGCCGCTACCGTCAACGGGGCCGGAGAGGGA
GAGGGCCAGACGCAACAGGCAGAGGCCAGCAGCAGCTCGTAG
Gene >Hirsu2|490
ATGGCTGTCCGCGAGGACCTGGTGGTCTCTGCAGTAGGTGGTCTCCCCCGTGCCCTCTCCGCCACGTCATCACGT
GCTGCTTGCTAACAGTCGGATCGCAACGCAGGCGCAGTGTCAGTCTCAAACAAGGGCGAAGTCGAGCACCTCCTG
AGGATGCCCGCTAACTCGGAGCGCAGTCCTGCAGGACCCCAGCGTTGCCTCGTCGTCGGTCGAGAACAAGATCTC
CTTTCTGCGAAGCAAGAACCTGACGCAGGAGGAGATCGACGCTGCCCTCGCCCGAACCGGGCCGTCGCCTCCCAC
CGCAGCGCCACCTGCCGGCCCTCCGCAGCCGTACTATCCACCCTATCCTCCGAATGCGTGGCAGCAGACGCCTCC
GTACCCTCCGCCGAGGCGGGACTGGCGAGACTGGTTCATAATGGCGACTGTCGTCGGCGGCGTGGGATACGGCCT
GTACACGCTTGGAAAGGTACTTGACATGTTGGAGTCGCTTGACCTGGCGTGTCCCATGAGCTGACGAGAGACGGG
CAGCGCTACGTTTTCCCGCTGGTGGCGCCGCCGACTCCGGATAGGCTGGCGCAGGACAAGAAATCGATCGAGGAG
CAGTTCGACCGGGCGTTTGTGCTGGTGGAGCAGCTGGCCAAGGACACGGAGGCGCTCAAAAGGGCAGAGCAGCAG
AGGACGGAGAGACTGGACACGGCGCTGGTGGAGCTCGAGCGGACGGTGACTGACCTGAAATCGGCGAACCGACGT
CGCGAGGACGACGCGCAGCGGATCCGCGACGAAGTACAGTCTCTCAAAGACGCGATCCCGCAAGCGATGAGCAGC
CAGAAAGATGTGACGGACAATCGGCTGTCGGAAATCAACAGCGAGCTCGCCAGCCTCAAGACGCTGGTCTCGCAG
CGCATGGCGTCGGCGTCGGCGTCGGCGCCCGGCCACGCTCTACGAGCCGGCATGTCCAGCGGCAGCGGCAGCGGC
AGCGGCAGCGGCAGCGGCAGCGGCAGCGCAGGTGCAAGCGGAAACGGGAGCGGCAGCGACAAGGCCGGGGAGGGG
TTCGCCAACGCAACAACGACCGAGACGTCGAGCAAGAGTGCGGCACAAAACAGCGTCGGCAGACCGCTGGGCTTC
GGCAGCACCAACGGCGGCGGCAGAGCATCGATCCCGGCGTGGCAGATGGCGGCGGCGGCCAACAGCAACGGGACG
GACGACAAGGGCGCCCCGGCCGCTACCGTCAACGGGGCCGGAGAGGGAGAGGGCCAGACGCAACAGGCAGAGGCC
AGCAGCAGCTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail