Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4897
Gene name
LocationContig_2467:486..1903
Strand-
Gene length (bp)1417
Transcript length (bp)1341
Coding sequence length (bp)1341
Protein length (aa) 447

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08124 Lyase_8_N Polysaccharide lyase family 8, N terminal alpha-helical domain 1.2E-58 221 407

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CZ01|HYSA_PROAC Hyaluronate lyase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=PPA0380 PE=3 SV=1 216 406 1.0E-30
sp|P0CZ00|HYSA_PROAA Hyaluronate lyase OS=Propionibacterium acnes PE=1 SV=1 216 406 1.0E-29
sp|Q54873|HYSA_STRPN Hyaluronate lyase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=SP_0314 PE=1 SV=2 224 424 3.0E-25
sp|Q9AQS0|XANLY_BACGL Xanthan lyase OS=Bacillus sp. (strain GL1) GN=xly PE=1 SV=1 224 417 2.0E-23
sp|Q53591|HYSA_STRA3 Hyaluronate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=hylB PE=1 SV=2 224 406 1.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CZ01|HYSA_PROAC Hyaluronate lyase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=PPA0380 PE=3 SV=1 216 406 1.0E-30
sp|P0CZ00|HYSA_PROAA Hyaluronate lyase OS=Propionibacterium acnes PE=1 SV=1 216 406 1.0E-29
sp|Q54873|HYSA_STRPN Hyaluronate lyase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=SP_0314 PE=1 SV=2 224 424 3.0E-25
sp|Q9AQS0|XANLY_BACGL Xanthan lyase OS=Bacillus sp. (strain GL1) GN=xly PE=1 SV=1 224 417 2.0E-23
sp|Q53591|HYSA_STRA3 Hyaluronate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=hylB PE=1 SV=2 224 406 1.0E-21
sp|Q59801|HYSA_STAA8 Hyaluronate lyase OS=Staphylococcus aureus (strain NCTC 8325) GN=hysA PE=3 SV=1 224 406 9.0E-15
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4897
MRLGGLVPVLFALGALCGDTTPNSTQTAQKDLVLLQPAGPTQPGLAADLNCNGFIEIRPGDDCLDIAERAGADER
QVTKWNSPTDPRCRGLRDGHWGCVSVGPNFDKLRLRWRELILETDFPADSEPFAARLASLGRQAARHRDSFAPTT
GQLWADLPYMYADVDINPGNKSVPLCCVDPDVAPEDESGPTPAVDTDVDSEDKPGPLPSADSDTNAGDKPRPPSS
AVTRTFERLLIMANAWAQRGTGLTGDSGLLAVILEGLDRLQGEVYNDSQTMYGNWWDWKIGIPRALMDLCALLDG
HLGADRVAGLVAANDHFVPNSAVASYRGTSTAANRVDLCRSIVFSGIFGSAPARLDVARDALPPVFDLVTSGDGF
YADGSFVQHGNVPYTGTYGAEMIKGLAGLIPSRPSSTTAWPWTASRAAPSAAGAGAATTAAATTSWPASCC*
Coding >Hirsu2|4897
ATGAGGCTCGGCGGGCTGGTCCCCGTCCTGTTCGCCCTGGGGGCTCTCTGCGGTGACACGACTCCTAACAGCACG
CAAACGGCCCAGAAAGATCTGGTCCTGTTGCAGCCAGCAGGGCCAACTCAGCCCGGGCTTGCCGCGGACCTGAAC
TGCAATGGATTCATCGAGATCAGACCGGGGGATGACTGTCTTGACATCGCCGAAAGGGCCGGGGCCGACGAACGT
CAGGTCACCAAGTGGAACTCGCCGACGGACCCTCGTTGTCGCGGTCTCCGGGACGGGCACTGGGGCTGCGTCTCG
GTCGGGCCGAATTTCGACAAGTTGCGGCTGCGCTGGCGCGAGCTCATCCTCGAGACCGATTTCCCTGCCGACTCG
GAGCCGTTCGCGGCCAGGCTCGCCTCTCTGGGAAGGCAGGCGGCCCGGCACCGTGACAGCTTCGCTCCGACCACC
GGCCAACTCTGGGCCGACCTGCCGTACATGTACGCCGATGTGGACATCAACCCCGGCAACAAGTCCGTTCCTCTC
TGCTGCGTCGATCCGGATGTCGCCCCCGAGGACGAGTCCGGACCGACCCCGGCTGTCGATACGGATGTCGACTCC
GAGGACAAGCCCGGACCACTCCCCTCTGCCGATTCGGACACGAACGCCGGCGACAAGCCCCGCCCACCCTCCTCC
GCCGTCACCCGGACCTTCGAACGGCTTCTCATCATGGCCAACGCCTGGGCCCAGCGAGGCACCGGCCTGACCGGC
GACTCGGGCCTGCTGGCCGTGATCCTCGAGGGCCTCGACCGGCTGCAGGGCGAGGTCTACAACGACTCCCAGACC
ATGTACGGGAACTGGTGGGACTGGAAGATCGGGATCCCCCGGGCGCTCATGGACCTGTGCGCGCTCCTGGACGGC
CATCTCGGCGCCGACCGCGTCGCCGGGCTGGTGGCGGCCAACGACCACTTCGTGCCGAACTCGGCCGTCGCCAGC
TACCGCGGGACCAGCACGGCGGCCAACCGGGTCGACCTGTGCCGGTCCATCGTCTTCTCCGGCATCTTCGGCTCG
GCGCCGGCGCGGCTCGACGTGGCTCGCGACGCCCTCCCGCCGGTCTTCGACCTGGTCACCTCGGGCGACGGCTTC
TACGCCGACGGCTCCTTCGTCCAGCACGGGAACGTCCCGTACACGGGCACGTACGGCGCCGAGATGATCAAGGGC
CTGGCCGGGCTAATTCCTTCGCGCCCGTCATCTACAACGGCCTGGCCATGGACGGCGTCTCGGGCCGCGCCATCA
GCCGCGGGCGCCGGAGCAGCGACCACAGCCGCGGCCACGACATCATGGCCAGCATCCTGCTGCTGA
Transcript >Hirsu2|4897
ATGAGGCTCGGCGGGCTGGTCCCCGTCCTGTTCGCCCTGGGGGCTCTCTGCGGTGACACGACTCCTAACAGCACG
CAAACGGCCCAGAAAGATCTGGTCCTGTTGCAGCCAGCAGGGCCAACTCAGCCCGGGCTTGCCGCGGACCTGAAC
TGCAATGGATTCATCGAGATCAGACCGGGGGATGACTGTCTTGACATCGCCGAAAGGGCCGGGGCCGACGAACGT
CAGGTCACCAAGTGGAACTCGCCGACGGACCCTCGTTGTCGCGGTCTCCGGGACGGGCACTGGGGCTGCGTCTCG
GTCGGGCCGAATTTCGACAAGTTGCGGCTGCGCTGGCGCGAGCTCATCCTCGAGACCGATTTCCCTGCCGACTCG
GAGCCGTTCGCGGCCAGGCTCGCCTCTCTGGGAAGGCAGGCGGCCCGGCACCGTGACAGCTTCGCTCCGACCACC
GGCCAACTCTGGGCCGACCTGCCGTACATGTACGCCGATGTGGACATCAACCCCGGCAACAAGTCCGTTCCTCTC
TGCTGCGTCGATCCGGATGTCGCCCCCGAGGACGAGTCCGGACCGACCCCGGCTGTCGATACGGATGTCGACTCC
GAGGACAAGCCCGGACCACTCCCCTCTGCCGATTCGGACACGAACGCCGGCGACAAGCCCCGCCCACCCTCCTCC
GCCGTCACCCGGACCTTCGAACGGCTTCTCATCATGGCCAACGCCTGGGCCCAGCGAGGCACCGGCCTGACCGGC
GACTCGGGCCTGCTGGCCGTGATCCTCGAGGGCCTCGACCGGCTGCAGGGCGAGGTCTACAACGACTCCCAGACC
ATGTACGGGAACTGGTGGGACTGGAAGATCGGGATCCCCCGGGCGCTCATGGACCTGTGCGCGCTCCTGGACGGC
CATCTCGGCGCCGACCGCGTCGCCGGGCTGGTGGCGGCCAACGACCACTTCGTGCCGAACTCGGCCGTCGCCAGC
TACCGCGGGACCAGCACGGCGGCCAACCGGGTCGACCTGTGCCGGTCCATCGTCTTCTCCGGCATCTTCGGCTCG
GCGCCGGCGCGGCTCGACGTGGCTCGCGACGCCCTCCCGCCGGTCTTCGACCTGGTCACCTCGGGCGACGGCTTC
TACGCCGACGGCTCCTTCGTCCAGCACGGGAACGTCCCGTACACGGGCACGTACGGCGCCGAGATGATCAAGGGC
CTGGCCGGGCTAATTCCTTCGCGCCCGTCATCTACAACGGCCTGGCCATGGACGGCGTCTCGGGCCGCGCCATCA
GCCGCGGGCGCCGGAGCAGCGACCACAGCCGCGGCCACGACATCATGGCCAGCATCCTGCTGCTGA
Gene >Hirsu2|4897
ATGAGGCTCGGCGGGCTGGTCCCCGTCCTGTTCGCCCTGGGGGCTCTCTGCGGTGACACGACTCCTAACAGCACG
CAAACGGCCCAGAAAGATCTGGTCCTGTTGCAGCCAGCAGGGCCAACTCAGCCCGGGCTTGCCGCGGACCTGAAC
TGCAATGGATTCATCGAGATCAGACCGGGGGATGACTGTCTTGACATCGCCGAAAGGGCCGGGGCCGACGAACGT
CAGGTCACCAAGTGGAACTCGCCGACGGACCCTCGTTGTCGCGGTCTCCGGGACGGGCACTGGGGCTGCGTCTCG
GTCGGGCCGAATTTCGACAAGTTGCGGCTGCGCTGGCGCGAGCTCATCCTCGAGACCGATTTCCCTGCCGACTCG
GAGCCGTTCGCGGCCAGGCTCGCCTCTCTGGGAAGGCAGGCGGCCCGGCACCGTGACAGCTTCGCTCCGACCACC
GGCCAACTCTGGGCCGACCTGCCGTACATGTACGCCGATGTGGACATCAACCCCGGCAACAAGTCCGTTCCTCTC
TGCTGCGTCGATCCGGATGTCGCCCCCGAGGACGAGTCCGGACCGACCCCGGCTGTCGATACGGATGTCGACTCC
GAGGACAAGCCCGGACCACTCCCCTCTGCCGATTCGGACACGAACGCCGGCGACAAGCCCCGCCCACCCTCCTCC
GCCGTCACCCGGACCTTCGAACGGCTTCTCATCATGGCCAACGCCTGGGCCCAGCGAGGCACCGGCCTGACCGGC
GACTCGGGCCTGCTGGCCGTGATCCTCGAGGGCCTCGACCGGCTGCAGGGCGAGGTCTACAACGACTCCCAGACC
ATGTACGGGAACTGGTGGGACTGGAAGATCGGGATCCCCCGGGCGCTCATGGACCTGTGCGCGCTCCTGGACGGC
CATCTCGGCGCCGACCGCGTCGCCGGGCTGGTGGCGGCCAACGACCACTTCGTGCCGAACTCGGCCGTCGCCAGC
TACCGCGGGACCAGCACGGCGGCCAACCGGGTCGACCTGTGCCGGTCCATCGTCTTCTCCGGCATCTTCGGCTCG
GCGCCGGCGCGGCTCGACGTGGCTCGCGACGCCCTCCCGCCGGTCTTCGACCTGGTCACCTCGGGCGACGGCTTC
TACGCCGACGGCTCCTTCGTCCAGCACGGGAACGTCCCGTACACGGGCACGTACGGCGCCGAGATGATCAAGGGC
CTGGCCGGGCTGTCCGCCCTCTTCGCGGGCTCTGACTGGCGACTCATCACCAGCCCGAGCTGGCAGCTGTTCCTC
AACAGCGTCGAGAATTCCTTCGCGCCCGTCATCTACAACGGCCTGGCCATGGACGGCGTCTCGGGCCGCGCCATC
AGCCGCGGGCGCCGGAGCAGCGACCACAGCCGCGGCCACGACATCATGGCCAGCATCCTGCTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail