Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4893
Gene name
LocationContig_2463:95..1466
Strand-
Gene length (bp)1371
Transcript length (bp)1080
Coding sequence length (bp)1080
Protein length (aa) 360

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03151 TPT Triose-phosphate Transporter family 6.9E-11 131 320

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10354|YDB1_SCHPO Uncharacterized transporter C22E12.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22E12.01 PE=3 SV=2 108 340 3.0E-50
sp|Q8H184|PT106_ARATH Probable sugar phosphate/phosphate translocator At1g06470 OS=Arabidopsis thaliana GN=At1g06470 PE=2 SV=1 106 353 9.0E-37
sp|Q8VCX2|S35C2_MOUSE Solute carrier family 35 member C2 OS=Mus musculus GN=Slc35c2 PE=1 SV=1 123 340 2.0E-30
sp|Q03697|YMD8_YEAST Putative nucleotide-sugar transporter YMD8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMD8 PE=1 SV=1 133 333 1.0E-29
sp|Q9NQQ7|S35C2_HUMAN Solute carrier family 35 member C2 OS=Homo sapiens GN=SLC35C2 PE=1 SV=2 134 340 4.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10354|YDB1_SCHPO Uncharacterized transporter C22E12.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22E12.01 PE=3 SV=2 108 340 3.0E-50
sp|Q8H184|PT106_ARATH Probable sugar phosphate/phosphate translocator At1g06470 OS=Arabidopsis thaliana GN=At1g06470 PE=2 SV=1 106 353 9.0E-37
sp|Q8VCX2|S35C2_MOUSE Solute carrier family 35 member C2 OS=Mus musculus GN=Slc35c2 PE=1 SV=1 123 340 2.0E-30
sp|Q03697|YMD8_YEAST Putative nucleotide-sugar transporter YMD8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMD8 PE=1 SV=1 133 333 1.0E-29
sp|Q9NQQ7|S35C2_HUMAN Solute carrier family 35 member C2 OS=Homo sapiens GN=SLC35C2 PE=1 SV=2 134 340 4.0E-29
sp|Q3E6T0|PT525_ARATH Probable sugar phosphate/phosphate translocator At5g25400 OS=Arabidopsis thaliana GN=At5g25400 PE=2 SV=1 121 338 6.0E-15
sp|Q9SUV2|PT432_ARATH Probable sugar phosphate/phosphate translocator At4g32390 OS=Arabidopsis thaliana GN=At4g32390 PE=3 SV=1 123 338 8.0E-15
sp|Q9SKJ7|PT225_ARATH Probable sugar phosphate/phosphate translocator At2g25520 OS=Arabidopsis thaliana GN=At2g25520 PE=1 SV=1 123 338 1.0E-14
sp|Q94EI9|PT314_ARATH Probable sugar phosphate/phosphate translocator At3g14410 OS=Arabidopsis thaliana GN=At3g14410 PE=2 SV=1 116 338 8.0E-14
sp|Q9LFN3|PT511_ARATH Probable sugar phosphate/phosphate translocator At5g11230 OS=Arabidopsis thaliana GN=At5g11230 PE=2 SV=1 121 338 2.0E-13
sp|Q9C8M1|PT153_ARATH Probable sugar phosphate/phosphate translocator At1g53660 OS=Arabidopsis thaliana GN=At1g53660 PE=3 SV=2 134 338 2.0E-12
sp|Q9LRP2|PT317_ARATH Probable sugar phosphate/phosphate translocator At3g17430 OS=Arabidopsis thaliana GN=At3g17430 PE=1 SV=1 144 338 6.0E-11
sp|Q9SFE9|GONS5_ARATH GDP-mannose transporter GONST5 OS=Arabidopsis thaliana GN=GONST5 PE=2 SV=1 134 299 2.0E-07
sp|Q9C521|UGAL1_ARATH UDP-galactose transporter 1 OS=Arabidopsis thaliana GN=UDP-GALT1 PE=2 SV=1 132 299 4.0E-07
sp|Q9LNH5|PT148_ARATH Probable sugar phosphate/phosphate translocator At1g48230 OS=Arabidopsis thaliana GN=At1g48230 PE=2 SV=2 144 338 2.0E-06
sp|Q9FYE5|PT504_ARATH Probable sugar phosphate/phosphate translocator At5g04160 OS=Arabidopsis thaliana GN=At5g04160 PE=2 SV=1 134 339 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 127 146 19
2 161 183 22
3 215 234 19
4 244 266 22
5 273 292 19
6 296 315 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4893
MEPVVGHRRRKSSLINPVGAHLPAHANAHAHAHAHRARLSITIPHESRDEDAASARAGDFAKPESSRDSFSDQDA
HDDEEMGLTSRDRDRRRRKRRRNTRLDNRIAQEKDVSPDEMKEADQDVMRRLLVNGLFILLWYMFSLSISLYNKW
MFDQNRLNFAFPLFTTSMHMLVQFVLAGLVLYFVPSLRPHAHSSDGGRSRHETEPNNSTGMSKMFYLTRIGPCGA
ATGLDIGLGNASLKFISLTFYTMCKSSSLAFVLLFAFLFRLETPTWRLVTIIAIMTMGVILMVFGEVQFKLGGFV
LVISAAFFSGFRWGLTQILLLRNPATSNPFSSIFFLSPVIGAPSRRRSSCSSPAASPSS*
Coding >Hirsu2|4893
ATGGAGCCCGTCGTGGGCCACCGGCGGCGCAAGAGCAGCCTCATCAATCCGGTTGGGGCCCATCTGCCCGCCCAC
GCCAACGCCCACGCCCACGCCCACGCCCACCGCGCCCGCCTCTCCATCACCATCCCCCACGAGTCCCGCGATGAG
GACGCGGCCTCGGCCCGCGCCGGCGACTTCGCCAAGCCCGAGTCGTCCCGCGACAGCTTCAGCGACCAGGACGCC
CACGACGACGAGGAGATGGGCCTGACGAGCAGAGACCGCGACCGCCGCCGCCGCAAGCGCCGCCGGAACACGCGC
CTCGACAACCGCATCGCCCAGGAGAAGGACGTGTCGCCCGACGAGATGAAGGAGGCCGACCAGGACGTCATGCGC
CGCCTGCTCGTCAATGGCCTCTTCATCCTGTTGTGGTACATGTTCTCGCTCTCCATCTCTCTCTACAACAAGTGG
ATGTTTGACCAAAACCGACTTAATTTCGCCTTTCCCCTCTTCACCACGTCGATGCACATGCTCGTGCAATTCGTC
CTGGCCGGCCTGGTCCTGTACTTTGTACCCTCGCTGCGGCCCCACGCCCACAGCTCCGACGGCGGCCGCTCTCGC
CACGAGACGGAGCCCAACAACAGCACCGGCATGTCCAAGATGTTCTACCTGACGCGCATCGGGCCCTGCGGCGCC
GCCACCGGCCTCGACATCGGGCTCGGGAACGCCTCTCTCAAGTTCATCAGCCTCACCTTTTACACCATGTGCAAG
TCGTCGTCGCTCGCCTTCGTCCTCCTCTTCGCCTTCCTCTTCCGGCTCGAGACGCCGACGTGGCGGCTGGTGACC
ATCATCGCCATCATGACCATGGGCGTCATCCTCATGGTCTTCGGCGAGGTGCAGTTCAAGCTCGGCGGCTTCGTC
CTCGTCATCTCGGCCGCCTTCTTCTCCGGCTTCCGCTGGGGCCTGACGCAGATCCTGCTGCTGCGCAACCCGGCC
ACGTCGAACCCCTTCTCCAGCATCTTCTTCCTGTCGCCCGTCATTGGGGCCCCGTCACGGCGCCGCTCTTCCTGC
TCTTCCCCGGCTGCATCGCCTTCCTCATGA
Transcript >Hirsu2|4893
ATGGAGCCCGTCGTGGGCCACCGGCGGCGCAAGAGCAGCCTCATCAATCCGGTTGGGGCCCATCTGCCCGCCCAC
GCCAACGCCCACGCCCACGCCCACGCCCACCGCGCCCGCCTCTCCATCACCATCCCCCACGAGTCCCGCGATGAG
GACGCGGCCTCGGCCCGCGCCGGCGACTTCGCCAAGCCCGAGTCGTCCCGCGACAGCTTCAGCGACCAGGACGCC
CACGACGACGAGGAGATGGGCCTGACGAGCAGAGACCGCGACCGCCGCCGCCGCAAGCGCCGCCGGAACACGCGC
CTCGACAACCGCATCGCCCAGGAGAAGGACGTGTCGCCCGACGAGATGAAGGAGGCCGACCAGGACGTCATGCGC
CGCCTGCTCGTCAATGGCCTCTTCATCCTGTTGTGGTACATGTTCTCGCTCTCCATCTCTCTCTACAACAAGTGG
ATGTTTGACCAAAACCGACTTAATTTCGCCTTTCCCCTCTTCACCACGTCGATGCACATGCTCGTGCAATTCGTC
CTGGCCGGCCTGGTCCTGTACTTTGTACCCTCGCTGCGGCCCCACGCCCACAGCTCCGACGGCGGCCGCTCTCGC
CACGAGACGGAGCCCAACAACAGCACCGGCATGTCCAAGATGTTCTACCTGACGCGCATCGGGCCCTGCGGCGCC
GCCACCGGCCTCGACATCGGGCTCGGGAACGCCTCTCTCAAGTTCATCAGCCTCACCTTTTACACCATGTGCAAG
TCGTCGTCGCTCGCCTTCGTCCTCCTCTTCGCCTTCCTCTTCCGGCTCGAGACGCCGACGTGGCGGCTGGTGACC
ATCATCGCCATCATGACCATGGGCGTCATCCTCATGGTCTTCGGCGAGGTGCAGTTCAAGCTCGGCGGCTTCGTC
CTCGTCATCTCGGCCGCCTTCTTCTCCGGCTTCCGCTGGGGCCTGACGCAGATCCTGCTGCTGCGCAACCCGGCC
ACGTCGAACCCCTTCTCCAGCATCTTCTTCCTGTCGCCCGTCATTGGGGCCCCGTCACGGCGCCGCTCTTCCTGC
TCTTCCCCGGCTGCATCGCCTTCCTCATGA
Gene >Hirsu2|4893
ATGGAGCCCGTCGTGGGCCACCGGCGGCGCAAGAGCAGCCTCATCAATCCGGTTGGGGCCCATCTGCCCGCCCAC
GCCAACGCCCACGCCCACGCCCACGCCCACCGCGCCCGCCTCTCCATCACCATCCCCCACGAGTCCCGCGATGAG
GACGCGGCCTCGGCCCGCGCCGGCGACTTCGCCAAGCCCGAGTCGTCCCGCGACAGCTTCAGCGACCAGGACGCC
CACGACGACGAGGAGATGGGCCTGACGAGCAGAGACCGCGACCGCCGCCGCCGCAAGCGCCGCCGGAACACGCGC
CTCGACAACCGCATCGCCCAGGAGAAGGACGTGTCGCCCGACGAGATGAAGGAGGCCGACCAGGACGTCATGCGC
CGCCTGCTCGTCAATGGCCTCTTCATCCTGTTGTGGTACATGTTCTCGCTCTCCATCTCTCTCGTGCGTTGCCCC
CTATTCCCGGTCCCGCTTCTGATATCCGGCCTCCCCCCCCTTTTCCCCCCCCTCACCTGGCCTCCCTCCCAACCC
AGCCTCGTGTTTGAGTCGACCGCGGACCCCGGGCTAATGATCGCGAAATGCGTACAGTACAACAAGTGGATGTTT
GACCAAAACCGACTTAATTTCGCCTTTCCCCTCTTCACCACGTCGATGCACATGCTCGTGCAATTCGTCCTGGCC
GGCCTGGTCCTGTACTTTGTACCCTCGCTGCGGCCCCACGCCCACAGCTCCGACGGCGGCCGCTCTCGCCACGAG
ACGGAGCCCAACAACAGCACCGGCATGTCCAAGATGTTCTACCTGACGCGCATCGGGCCCTGCGGCGCCGCCACC
GGCCTCGACATCGGGCTCGGGAACGCCTCTCTCAAGTTCATCAGCCTCACCTTTTACAGTACGTGTTTTTGCTCC
CCCCATAGGCGTGCGCGCGCGACGTGATGCTGACGAGTCGCCGACCAGCCATGTGCAAGTCGTCGTCGCTCGCCT
TCGTCCTCCTCTTCGCCTTCCTCTTCCGGCTCGAGACGCCGACGTGGCGGCTGGTGACCATCATCGCCATCATGA
CCATGGGCGTCATCCTCATGGTCTTCGGCGAGGTGCAGTTCAAGCTCGGCGGCTTCGTCCTCGTCATCTCGGCCG
CCTTCTTCTCCGGCTTCCGCTGGGGCCTGACGCAGATCCTGCTGCTGCGCAACCCGGCCACGTCGAACCCCTTCT
CCAGCATCTTCTTCCTGTCGCCCGTCATGTTCGTCACCCTGCTCTCGCTCGCCATCCCCGTCGAGGGCTTCGGCC
CGCTGTGGGACGGCCTGCGGACGCTGGGCCGCGAGTGGGGCCCCGTCACGGCGCCGCTCTTCCTGCTCTTCCCCG
GCTGCATCGCCTTCCTCATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail