Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4892
Gene name
LocationContig_2462:1145..2595
Strand-
Gene length (bp)1450
Transcript length (bp)1125
Coding sequence length (bp)1125
Protein length (aa) 375

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03781 FGE-sulfatase Sulfatase-modifying factor enzyme 1 1.3E-15 69 370

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q7RX33|EGT1_NEUCR Ergothioneine biosynthesis protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=egt-1 PE=1 SV=3 1 372 2.0E-154
sp|O94632|EGT1_SCHPO Ergothioneine biosynthesis protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=egt1 PE=1 SV=4 1 371 1.0E-45
sp|O69671|EGTB_MYCTU Hercynine oxygenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=egtB PE=1 SV=1 71 372 4.0E-12
sp|A0R5N0|EGTB_MYCS2 Hercynine oxygenase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=egtB PE=1 SV=1 254 372 3.0E-09
sp|G7CFI3|EGTB_MYCTH Hercynine oxygenase OS=Mycobacterium thermoresistibile GN=egtB PE=1 SV=1 271 372 1.0E-08

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus 0.4249 0.6025 0.0592 0.0168 0.0362 0.0199 0.0608 0.1384 0.1506 0.0681

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup431
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3502
Ophiocordyceps australis map64 (Brazil) OphauB2|2562
Ophiocordyceps camponoti-floridani Ophcf2|00788
Ophiocordyceps camponoti-floridani Ophcf2|06366
Ophiocordyceps camponoti-rufipedis Ophun1|2144
Ophiocordyceps camponoti-rufipedis Ophun1|5263
Ophiocordyceps kimflemingae Ophio5|2512
Ophiocordyceps kimflemingae Ophio5|3579
Ophiocordyceps subramaniannii Hirsu2|4892 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4892
MHLETLLYMMLQSGRTLPPPNAPRPDFALIADEAARARVPNQWFDVPAQTITVGIDDPEDGTDPSVYFGWDNEKP
AREVSVHAFQAKGRPITNEEVQAEAAGASSAGINPRADNDAQYAQYLYSSNIDQVPASWSTGEEDGSASNGTASA
SNGSANGHGSRLPESYLQGKAVRTVYGLVPLVHALDWPVFASYDELARCASWMGGRVPTADEARSIYAYVEGQKK
EASTKSRLAKKVPAVNGHLVNDGVEETPPSASSSPSHELFADLTGANVGLHHWHPVPVTAHGGALAGRAGMGGVW
EWTSSALRRHDGFRPMALYPAYTADFFDGKHNIVLGGSWATHPRIAGRASFVNWYQHNYPYAWAGARLVRDLPS*
Coding >Hirsu2|4892
ATGCACCTCGAGACGCTGCTGTACATGATGCTGCAGAGCGGCAGGACGCTGCCGCCGCCCAACGCGCCGCGCCCG
GACTTTGCCCTCATCGCCGACGAGGCCGCCCGCGCCCGCGTGCCCAATCAGTGGTTCGACGTGCCGGCCCAGACC
ATCACCGTCGGCATCGACGATCCCGAGGACGGCACCGATCCGTCCGTTTACTTTGGCTGGGACAATGAAAAGCCC
GCCCGCGAGGTGTCTGTCCATGCCTTCCAAGCCAAGGGCCGGCCCATCACCAACGAAGAGGTCCAGGCTGAAGCA
GCTGGTGCCTCGTCCGCGGGGATAAATCCGAGAGCCGACAACGACGCGCAGTACGCCCAGTACCTTTACAGCTCC
AACATCGACCAGGTCCCGGCGTCCTGGTCGACCGGCGAGGAGGACGGCTCGGCCAGCAACGGCACGGCGTCGGCG
TCCAACGGCTCGGCCAACGGCCACGGCAGCCGGCTTCCCGAGTCCTACCTGCAGGGCAAGGCGGTGCGGACGGTG
TACGGGCTGGTGCCGCTGGTGCACGCGCTCGACTGGCCCGTCTTCGCCTCGTACGACGAGCTGGCGCGGTGCGCG
TCGTGGATGGGCGGCCGCGTGCCGACGGCGGACGAGGCCCGCAGCATCTACGCCTACGTCGAGGGCCAGAAGAAG
GAGGCGTCGACGAAGAGCAGGCTGGCCAAGAAGGTGCCGGCCGTCAACGGGCACCTCGTCAACGACGGCGTCGAG
GAGACCCCCCCCTCCGCTTCTTCCTCGCCGTCGCACGAGCTGTTCGCCGACCTCACCGGCGCCAACGTCGGCCTC
CACCACTGGCACCCCGTGCCGGTGACGGCGCACGGCGGCGCGCTGGCCGGCCGCGCCGGCATGGGCGGCGTCTGG
GAGTGGACCAGCTCGGCGCTGCGCCGCCACGACGGCTTCCGTCCCATGGCCCTCTACCCGGCCTACACGGCCGAC
TTCTTCGACGGCAAGCACAACATCGTCCTCGGCGGCTCCTGGGCCACCCACCCGCGCATCGCCGGCCGCGCCAGC
TTCGTCAACTGGTACCAGCACAACTACCCCTATGCCTGGGCCGGCGCCCGCCTCGTGCGCGACCTCCCGTCGTGA
Transcript >Hirsu2|4892
ATGCACCTCGAGACGCTGCTGTACATGATGCTGCAGAGCGGCAGGACGCTGCCGCCGCCCAACGCGCCGCGCCCG
GACTTTGCCCTCATCGCCGACGAGGCCGCCCGCGCCCGCGTGCCCAATCAGTGGTTCGACGTGCCGGCCCAGACC
ATCACCGTCGGCATCGACGATCCCGAGGACGGCACCGATCCGTCCGTTTACTTTGGCTGGGACAATGAAAAGCCC
GCCCGCGAGGTGTCTGTCCATGCCTTCCAAGCCAAGGGCCGGCCCATCACCAACGAAGAGGTCCAGGCTGAAGCA
GCTGGTGCCTCGTCCGCGGGGATAAATCCGAGAGCCGACAACGACGCGCAGTACGCCCAGTACCTTTACAGCTCC
AACATCGACCAGGTCCCGGCGTCCTGGTCGACCGGCGAGGAGGACGGCTCGGCCAGCAACGGCACGGCGTCGGCG
TCCAACGGCTCGGCCAACGGCCACGGCAGCCGGCTTCCCGAGTCCTACCTGCAGGGCAAGGCGGTGCGGACGGTG
TACGGGCTGGTGCCGCTGGTGCACGCGCTCGACTGGCCCGTCTTCGCCTCGTACGACGAGCTGGCGCGGTGCGCG
TCGTGGATGGGCGGCCGCGTGCCGACGGCGGACGAGGCCCGCAGCATCTACGCCTACGTCGAGGGCCAGAAGAAG
GAGGCGTCGACGAAGAGCAGGCTGGCCAAGAAGGTGCCGGCCGTCAACGGGCACCTCGTCAACGACGGCGTCGAG
GAGACCCCCCCCTCCGCTTCTTCCTCGCCGTCGCACGAGCTGTTCGCCGACCTCACCGGCGCCAACGTCGGCCTC
CACCACTGGCACCCCGTGCCGGTGACGGCGCACGGCGGCGCGCTGGCCGGCCGCGCCGGCATGGGCGGCGTCTGG
GAGTGGACCAGCTCGGCGCTGCGCCGCCACGACGGCTTCCGTCCCATGGCCCTCTACCCGGCCTACACGGCCGAC
TTCTTCGACGGCAAGCACAACATCGTCCTCGGCGGCTCCTGGGCCACCCACCCGCGCATCGCCGGCCGCGCCAGC
TTCGTCAACTGGTACCAGCACAACTACCCCTATGCCTGGGCCGGCGCCCGCCTCGTGCGCGACCTCCCGTCGTGA
Gene >Hirsu2|4892
ATGCACCTCGAGACGCTGCTGTACATGATGCTGCAGAGCGGCAGGACGCTGCCGCCGCCCAACGCGCCGCGCCCG
GACTTTGCCCTCATCGCCGACGAGGCCGCCCGCGCCCGCGTGCCCAATCAGTGGTTCGACGTGCCGGCCCAGACC
ATCACCGTCGGCATCGACGATCCCGAGGACGGCACCGATCCGTCCGTTTACTTTGGCTGGTACGAGAACTACCCC
CCCCCCCCCCCCCCTCTCTCGTCCCGTCTTCCGCATCCCTTGAGAGCAGCTCTGTCGAGGGCGCAAGTACGGGCG
AGGGACAGAAAGAGATGGAGGGTGAGGGAGAGATGGCGGCACTGACATGCTCCGCGTCTACGTCGTACTAGGGAC
AATGAAAAGCCCGCCCGCGAGGTGTCTGTCCATGCCTTCCAAGCCAAGGGCCGGCCCATCACCAACGAAGAGGTA
TGAGAGGCCCTCCCCCACTCCCCCTTTTCTGCCCTTCTCCCTCCTCTTCAGGTCCAGGCTGAAGCAGCTGGTGCC
TCGTCCGCGGGGATAAATCCGAGAGCCGACAACGACGCGCAGTACGCCCAGTACCTTTACAGCTCCAACATCGAC
CAGGTCCCGGCGTCCTGGTCGACCGGCGAGGAGGACGGCTCGGCCAGCAACGGCACGGCGTCGGCGTCCAACGGC
TCGGCCAACGGCCACGGCAGCCGGCTTCCCGAGTCCTACCTGCAGGGCAAGGCGGTGCGGACGGTGTACGGGCTG
GTGCCGCTGGTGCACGCGCTCGACTGGCCCGTCTTCGCCTCGTACGACGAGCTGGCGCGGTGCGCGTCGTGGATG
GGCGGCCGCGTGCCGACGGCGGACGAGGCCCGCAGCATCTACGCCTACGTCGAGGGCCAGAAGAAGGAGGCGTCG
ACGAAGAGCAGGCTGGCCAAGAAGGTGCCGGCCGTCAACGGGTGAGAGACGACGAAGCCTCCCCCCTTTCCTCGT
CACTCGGCCGAGAGAGAGGGAGAGACACTTGGAGAGAGAAGTCTTGGTTGCTGATGCTCAGGGGACGAAACATAG
GCACCTCGTCAACGACGGCGTCGAGGAGACCCCCCCCTCCGCTTCTTCCTCGCCGTCGCACGAGCTGTTCGCCGA
CCTCACCGGCGCCAACGTCGGCCTCCACCACTGGCACCCCGTGCCGGTGACGGCGCACGGCGGCGCGCTGGCCGG
CCGCGCCGGCATGGGCGGCGTCTGGGAGTGGACCAGCTCGGCGCTGCGCCGCCACGACGGCTTCCGTCCCATGGC
CCTCTACCCGGCCTACACGGCCGACTTCTTCGACGGCAAGCACAACATCGTCCTCGGCGGCTCCTGGGCCACCCA
CCCGCGCATCGCCGGCCGCGCCAGCTTCGTCAACTGGTACCAGCACAACTACCCCTATGCCTGGGCCGGCGCCCG
CCTCGTGCGCGACCTCCCGTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail