Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4875
Gene name
LocationContig_2454:1112..2414
Strand+
Gene length (bp)1302
Transcript length (bp)1302
Coding sequence length (bp)1302
Protein length (aa) 434

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00150 Cellulase Cellulase (glycosyl hydrolase family 5) 5.1E-16 77 388

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P23548|GUN_PAEPO Endoglucanase OS=Paenibacillus polymyxa PE=3 SV=2 47 427 1.0E-13

GO

GO Term Description Terminal node
GO:0071704 organic substance metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4875
MKSAATSRLVALVCYACASLCLAVERTPPQPTADRPRLPLSASSRWIVDAAGQRVKLRCINWAGHLEANIPEGLH
KKSVEHIADWIASQGFNCVRLTYSIDMARHQGVKVEDSFRRAAKATGADETAMMRLYAEAVKKNSFLVGSNGNAT
VIDVFDRVQSALWDRGVMTILDNHVSRAGWCCDLTDGNGWWKDARFYMADNSRYFDTAEWRDGLATIATWSRSRP
GIVGLSLRNELRASFSQIAFAAETWLSYMSPAARLVHDANPDALIIIGGINGGTDLSPLRTLAMMDLGPWAHKRV
WEAHSYSFTVTTPNFGICSLLKAEYGGLYGFVLEQDKPYTGPLFLSEFGVGMTGGPRDGLSDKDARYLTCLVDYM
SGNDADWSLWAIQGSYYVRDKVVDMNETWGALDHDWRDWRNPKFKAMLGKMVDMTQSP*
Coding >Hirsu2|4875
ATGAAGAGTGCCGCCACCTCTCGGCTCGTGGCTCTAGTCTGCTACGCGTGCGCCTCTTTGTGCCTTGCAGTGGAA
AGAACGCCGCCACAACCGACGGCCGACAGACCTAGGCTTCCCCTGAGCGCCTCAAGCCGCTGGATTGTGGATGCG
GCTGGACAACGCGTCAAGTTGCGATGCATCAACTGGGCCGGGCACCTCGAGGCCAACATCCCCGAGGGACTTCAC
AAGAAATCAGTCGAGCACATTGCCGACTGGATCGCCTCCCAGGGCTTCAACTGCGTGCGCTTGACCTACTCGATC
GACATGGCGCGCCATCAGGGCGTCAAGGTCGAAGACTCGTTCCGCAGGGCTGCCAAGGCCACGGGCGCGGACGAG
ACGGCCATGATGCGGCTGTACGCCGAGGCCGTTAAAAAGAATTCCTTCCTGGTAGGCAGCAACGGCAATGCCACT
GTTATCGATGTCTTCGACAGAGTTCAGTCGGCGCTCTGGGATCGTGGCGTAATGACCATACTCGACAACCACGTC
AGTCGGGCGGGCTGGTGCTGTGATCTGACCGATGGCAACGGCTGGTGGAAGGACGCGCGCTTCTACATGGCCGAC
AACAGCCGTTACTTTGACACCGCCGAGTGGCGCGATGGACTCGCCACCATTGCTACATGGTCCCGGTCGCGGCCT
GGCATCGTAGGATTGTCGCTGCGTAACGAGCTTCGTGCCTCTTTTTCGCAAATCGCCTTCGCCGCCGAAACGTGG
CTGAGCTACATGTCGCCGGCGGCCCGGTTGGTCCATGACGCCAACCCGGACGCTCTCATCATCATCGGTGGCATC
AACGGCGGCACCGACCTGTCGCCACTGCGGACCCTGGCCATGATGGACTTGGGCCCCTGGGCCCACAAACGCGTG
TGGGAGGCGCACAGTTATAGCTTCACCGTTACGACGCCCAACTTCGGCATCTGCTCGCTGCTCAAGGCTGAGTAC
GGCGGCCTGTATGGCTTCGTCCTCGAGCAGGACAAGCCCTACACGGGGCCGCTCTTTCTATCCGAATTCGGCGTC
GGAATGACCGGCGGCCCTCGCGACGGGCTATCCGATAAGGACGCCCGCTACCTGACTTGTCTCGTTGACTATATG
TCGGGCAACGACGCTGACTGGTCGCTGTGGGCCATTCAGGGCTCCTACTACGTCCGCGATAAGGTCGTCGACATG
AACGAGACTTGGGGGGCCCTCGATCACGACTGGCGTGACTGGCGAAACCCCAAGTTCAAGGCCATGCTTGGCAAG
ATGGTGGATATGACCCAAAGTCCCTAA
Transcript >Hirsu2|4875
ATGAAGAGTGCCGCCACCTCTCGGCTCGTGGCTCTAGTCTGCTACGCGTGCGCCTCTTTGTGCCTTGCAGTGGAA
AGAACGCCGCCACAACCGACGGCCGACAGACCTAGGCTTCCCCTGAGCGCCTCAAGCCGCTGGATTGTGGATGCG
GCTGGACAACGCGTCAAGTTGCGATGCATCAACTGGGCCGGGCACCTCGAGGCCAACATCCCCGAGGGACTTCAC
AAGAAATCAGTCGAGCACATTGCCGACTGGATCGCCTCCCAGGGCTTCAACTGCGTGCGCTTGACCTACTCGATC
GACATGGCGCGCCATCAGGGCGTCAAGGTCGAAGACTCGTTCCGCAGGGCTGCCAAGGCCACGGGCGCGGACGAG
ACGGCCATGATGCGGCTGTACGCCGAGGCCGTTAAAAAGAATTCCTTCCTGGTAGGCAGCAACGGCAATGCCACT
GTTATCGATGTCTTCGACAGAGTTCAGTCGGCGCTCTGGGATCGTGGCGTAATGACCATACTCGACAACCACGTC
AGTCGGGCGGGCTGGTGCTGTGATCTGACCGATGGCAACGGCTGGTGGAAGGACGCGCGCTTCTACATGGCCGAC
AACAGCCGTTACTTTGACACCGCCGAGTGGCGCGATGGACTCGCCACCATTGCTACATGGTCCCGGTCGCGGCCT
GGCATCGTAGGATTGTCGCTGCGTAACGAGCTTCGTGCCTCTTTTTCGCAAATCGCCTTCGCCGCCGAAACGTGG
CTGAGCTACATGTCGCCGGCGGCCCGGTTGGTCCATGACGCCAACCCGGACGCTCTCATCATCATCGGTGGCATC
AACGGCGGCACCGACCTGTCGCCACTGCGGACCCTGGCCATGATGGACTTGGGCCCCTGGGCCCACAAACGCGTG
TGGGAGGCGCACAGTTATAGCTTCACCGTTACGACGCCCAACTTCGGCATCTGCTCGCTGCTCAAGGCTGAGTAC
GGCGGCCTGTATGGCTTCGTCCTCGAGCAGGACAAGCCCTACACGGGGCCGCTCTTTCTATCCGAATTCGGCGTC
GGAATGACCGGCGGCCCTCGCGACGGGCTATCCGATAAGGACGCCCGCTACCTGACTTGTCTCGTTGACTATATG
TCGGGCAACGACGCTGACTGGTCGCTGTGGGCCATTCAGGGCTCCTACTACGTCCGCGATAAGGTCGTCGACATG
AACGAGACTTGGGGGGCCCTCGATCACGACTGGCGTGACTGGCGAAACCCCAAGTTCAAGGCCATGCTTGGCAAG
ATGGTGGATATGACCCAAAGTCCCTAA
Gene >Hirsu2|4875
ATGAAGAGTGCCGCCACCTCTCGGCTCGTGGCTCTAGTCTGCTACGCGTGCGCCTCTTTGTGCCTTGCAGTGGAA
AGAACGCCGCCACAACCGACGGCCGACAGACCTAGGCTTCCCCTGAGCGCCTCAAGCCGCTGGATTGTGGATGCG
GCTGGACAACGCGTCAAGTTGCGATGCATCAACTGGGCCGGGCACCTCGAGGCCAACATCCCCGAGGGACTTCAC
AAGAAATCAGTCGAGCACATTGCCGACTGGATCGCCTCCCAGGGCTTCAACTGCGTGCGCTTGACCTACTCGATC
GACATGGCGCGCCATCAGGGCGTCAAGGTCGAAGACTCGTTCCGCAGGGCTGCCAAGGCCACGGGCGCGGACGAG
ACGGCCATGATGCGGCTGTACGCCGAGGCCGTTAAAAAGAATTCCTTCCTGGTAGGCAGCAACGGCAATGCCACT
GTTATCGATGTCTTCGACAGAGTTCAGTCGGCGCTCTGGGATCGTGGCGTAATGACCATACTCGACAACCACGTC
AGTCGGGCGGGCTGGTGCTGTGATCTGACCGATGGCAACGGCTGGTGGAAGGACGCGCGCTTCTACATGGCCGAC
AACAGCCGTTACTTTGACACCGCCGAGTGGCGCGATGGACTCGCCACCATTGCTACATGGTCCCGGTCGCGGCCT
GGCATCGTAGGATTGTCGCTGCGTAACGAGCTTCGTGCCTCTTTTTCGCAAATCGCCTTCGCCGCCGAAACGTGG
CTGAGCTACATGTCGCCGGCGGCCCGGTTGGTCCATGACGCCAACCCGGACGCTCTCATCATCATCGGTGGCATC
AACGGCGGCACCGACCTGTCGCCACTGCGGACCCTGGCCATGATGGACTTGGGCCCCTGGGCCCACAAACGCGTG
TGGGAGGCGCACAGTTATAGCTTCACCGTTACGACGCCCAACTTCGGCATCTGCTCGCTGCTCAAGGCTGAGTAC
GGCGGCCTGTATGGCTTCGTCCTCGAGCAGGACAAGCCCTACACGGGGCCGCTCTTTCTATCCGAATTCGGCGTC
GGAATGACCGGCGGCCCTCGCGACGGGCTATCCGATAAGGACGCCCGCTACCTGACTTGTCTCGTTGACTATATG
TCGGGCAACGACGCTGACTGGTCGCTGTGGGCCATTCAGGGCTCCTACTACGTCCGCGATAAGGTCGTCGACATG
AACGAGACTTGGGGGGCCCTCGATCACGACTGGCGTGACTGGCGAAACCCCAAGTTCAAGGCCATGCTTGGCAAG
ATGGTGGATATGACCCAAAGTCCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail