Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4873
Gene name
LocationContig_2452:1192..2633
Strand-
Gene length (bp)1441
Transcript length (bp)1371
Coding sequence length (bp)1371
Protein length (aa) 457

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03972 MmgE_PrpD MmgE/PrpD family 3.6E-142 1 428

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6C354|PRPD_YARLI 2-methylcitrate dehydratase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PDH1 PE=1 SV=1 1 452 0.0E+00
sp|P77243|PRPD_ECOLI 2-methylcitrate dehydratase OS=Escherichia coli (strain K12) GN=prpD PE=1 SV=3 1 450 0.0E+00
sp|Q8X693|PRPD_ECO57 2-methylcitrate dehydratase OS=Escherichia coli O157:H7 GN=prpD PE=3 SV=3 1 450 0.0E+00
sp|Q937N6|PRPD_CUPNE 2-methylcitrate dehydratase OS=Cupriavidus necator GN=prpD PE=3 SV=1 1 450 0.0E+00
sp|P74840|PRPD_SALTY 2-methylcitrate dehydratase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prpD PE=1 SV=2 1 450 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6C354|PRPD_YARLI 2-methylcitrate dehydratase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PDH1 PE=1 SV=1 1 452 0.0E+00
sp|P77243|PRPD_ECOLI 2-methylcitrate dehydratase OS=Escherichia coli (strain K12) GN=prpD PE=1 SV=3 1 450 0.0E+00
sp|Q8X693|PRPD_ECO57 2-methylcitrate dehydratase OS=Escherichia coli O157:H7 GN=prpD PE=3 SV=3 1 450 0.0E+00
sp|Q937N6|PRPD_CUPNE 2-methylcitrate dehydratase OS=Cupriavidus necator GN=prpD PE=3 SV=1 1 450 0.0E+00
sp|P74840|PRPD_SALTY 2-methylcitrate dehydratase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prpD PE=1 SV=2 1 450 0.0E+00
sp|Q8Z903|PRPD_SALTI 2-methylcitrate dehydratase OS=Salmonella typhi GN=prpD PE=3 SV=1 1 450 0.0E+00
sp|Q12428|PRPD_YEAST Probable 2-methylcitrate dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDH1 PE=1 SV=1 1 449 0.0E+00
sp|P45859|PRPD_BACSU 2-methylcitrate dehydratase OS=Bacillus subtilis (strain 168) GN=prpD PE=2 SV=3 1 448 2.0E-177
sp|Q54IJ0|PRPD_DICDI Probable 2-methylcitrate dehydratase OS=Dictyostelium discoideum GN=prpD PE=2 SV=1 1 450 1.0E-143
sp|Q8NSH9|PRPD1_CORGL 2-methylcitrate dehydratase 1 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=prpD1 PE=3 SV=1 32 396 2.0E-25
sp|Q8NSL3|PRPD2_CORGL 2-methylcitrate dehydratase 2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=prpD2 PE=2 SV=1 23 396 5.0E-21
sp|H8F0D6|PRPD_MYCTE 2-methylcitrate dehydratase OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=ERDMAN_1266 PE=1 SV=1 48 396 4.0E-17
sp|O06582|PRPD_MYCTU 2-methylcitrate dehydratase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=prpD PE=1 SV=1 48 396 4.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0016829 lyase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4873
LLDTLGCGLEGLRFRECAKLLGPVVPGTVVPNGTRVPGTPFVLDPVNGAFNIGTMIRWLDFNDCWLAAEWGHPSD
NLGAILAVADWVNRTNKAGGGLAGGRVFAVRDVLEAMIKAHEIQGCLALLNSFNRVGLDHVVLVKVASTAVVARM
LGLDERRIADAVTQAWVDGQSLRTYRHSPNTMSRKSWAAGDACQRAVNLALKVMKGESGIPTVLSAPVWGFYDVL
FKGNKFDFQRPYGSYVMENVLFKVSYPAEFHSQTAVEASEKIHKQLKAMGKSAADIKAVTCRTHEACIRIIDKQF
KPMDNFADRDHCIQYMCAVMLVFGRLEASDYVDGGEAATSPLVESLRQKIRCVEDGQYTRDYHDPKLRTISNALT
VELNDGTRLDEVAVEAPLGHRLRRDEAKPVILAKYKRHLGPHLPESRVKELVELGVDANRLDSMPVDEYVDLYTV
KESKFV*
Coding >Hirsu2|4873
CTGCTCGACACGCTCGGGTGCGGGCTCGAGGGCCTGCGCTTCCGTGAGTGCGCCAAGCTGCTGGGCCCCGTGGTG
CCGGGGACGGTGGTGCCGAACGGGACGCGGGTGCCGGGGACGCCGTTCGTGCTGGACCCGGTCAACGGGGCGTTC
AACATCGGCACCATGATCCGCTGGCTCGACTTCAACGACTGCTGGCTGGCGGCCGAGTGGGGCCACCCGTCGGAC
AACCTGGGCGCCATCCTGGCCGTGGCCGACTGGGTCAACCGGACCAACAAGGCCGGCGGCGGCCTGGCCGGCGGG
CGCGTCTTCGCCGTCCGCGACGTGCTCGAGGCCATGATCAAGGCGCACGAGATCCAGGGCTGCCTGGCCCTGCTC
AACTCCTTCAACCGCGTCGGCCTCGACCACGTGGTGCTCGTCAAGGTGGCCAGCACGGCCGTCGTCGCCCGCATG
CTCGGCCTCGACGAGCGCCGCATCGCCGACGCCGTCACCCAGGCCTGGGTCGACGGCCAGAGCCTGCGCACCTAC
CGCCACTCGCCCAACACCATGTCGCGCAAGTCGTGGGCCGCCGGCGACGCCTGCCAGCGCGCCGTCAACCTCGCC
CTCAAGGTCATGAAGGGCGAGAGCGGCATCCCGACCGTCCTGTCCGCCCCCGTCTGGGGCTTCTACGACGTCCTC
TTCAAGGGCAACAAGTTTGACTTTCAGCGCCCCTACGGCAGCTACGTCATGGAGAATGTCCTCTTCAAGGTCTCC
TATCCGGCCGAGTTCCACTCGCAGACGGCCGTCGAGGCCTCGGAGAAGATCCACAAGCAGCTCAAGGCCATGGGC
AAGTCGGCGGCCGACATCAAGGCCGTGACGTGCCGCACGCACGAGGCCTGCATCCGCATCATCGACAAGCAGTTC
AAGCCCATGGACAACTTCGCCGACCGCGACCACTGCATCCAGTACATGTGCGCCGTCATGCTCGTCTTCGGCCGG
CTCGAGGCCTCCGACTACGTCGACGGCGGCGAGGCCGCCACCTCGCCGCTCGTCGAGTCGCTGCGCCAGAAGATC
CGCTGCGTCGAGGACGGCCAGTACACGCGCGACTACCACGACCCCAAGCTGCGCACCATCTCCAACGCGCTGACC
GTCGAGCTCAACGACGGCACCCGCCTCGACGAGGTGGCCGTCGAGGCGCCCCTCGGCCACCGCCTGCGCCGCGAC
GAGGCCAAGCCCGTCATCCTGGCCAAGTACAAGCGCCACCTGGGCCCGCACCTGCCCGAGAGCAGGGTCAAGGAG
CTGGTCGAGCTCGGCGTCGACGCCAACAGGCTCGACTCGATGCCCGTCGACGAGTACGTCGACCTGTACACCGTC
AAGGAGAGCAAGTTCGTCTGA
Transcript >Hirsu2|4873
CTGCTCGACACGCTCGGGTGCGGGCTCGAGGGCCTGCGCTTCCGTGAGTGCGCCAAGCTGCTGGGCCCCGTGGTG
CCGGGGACGGTGGTGCCGAACGGGACGCGGGTGCCGGGGACGCCGTTCGTGCTGGACCCGGTCAACGGGGCGTTC
AACATCGGCACCATGATCCGCTGGCTCGACTTCAACGACTGCTGGCTGGCGGCCGAGTGGGGCCACCCGTCGGAC
AACCTGGGCGCCATCCTGGCCGTGGCCGACTGGGTCAACCGGACCAACAAGGCCGGCGGCGGCCTGGCCGGCGGG
CGCGTCTTCGCCGTCCGCGACGTGCTCGAGGCCATGATCAAGGCGCACGAGATCCAGGGCTGCCTGGCCCTGCTC
AACTCCTTCAACCGCGTCGGCCTCGACCACGTGGTGCTCGTCAAGGTGGCCAGCACGGCCGTCGTCGCCCGCATG
CTCGGCCTCGACGAGCGCCGCATCGCCGACGCCGTCACCCAGGCCTGGGTCGACGGCCAGAGCCTGCGCACCTAC
CGCCACTCGCCCAACACCATGTCGCGCAAGTCGTGGGCCGCCGGCGACGCCTGCCAGCGCGCCGTCAACCTCGCC
CTCAAGGTCATGAAGGGCGAGAGCGGCATCCCGACCGTCCTGTCCGCCCCCGTCTGGGGCTTCTACGACGTCCTC
TTCAAGGGCAACAAGTTTGACTTTCAGCGCCCCTACGGCAGCTACGTCATGGAGAATGTCCTCTTCAAGGTCTCC
TATCCGGCCGAGTTCCACTCGCAGACGGCCGTCGAGGCCTCGGAGAAGATCCACAAGCAGCTCAAGGCCATGGGC
AAGTCGGCGGCCGACATCAAGGCCGTGACGTGCCGCACGCACGAGGCCTGCATCCGCATCATCGACAAGCAGTTC
AAGCCCATGGACAACTTCGCCGACCGCGACCACTGCATCCAGTACATGTGCGCCGTCATGCTCGTCTTCGGCCGG
CTCGAGGCCTCCGACTACGTCGACGGCGGCGAGGCCGCCACCTCGCCGCTCGTCGAGTCGCTGCGCCAGAAGATC
CGCTGCGTCGAGGACGGCCAGTACACGCGCGACTACCACGACCCCAAGCTGCGCACCATCTCCAACGCGCTGACC
GTCGAGCTCAACGACGGCACCCGCCTCGACGAGGTGGCCGTCGAGGCGCCCCTCGGCCACCGCCTGCGCCGCGAC
GAGGCCAAGCCCGTCATCCTGGCCAAGTACAAGCGCCACCTGGGCCCGCACCTGCCCGAGAGCAGGGTCAAGGAG
CTGGTCGAGCTCGGCGTCGACGCCAACAGGCTCGACTCGATGCCCGTCGACGAGTACGTCGACCTGTACACCGTC
AAGGAGAGCAAGTTCGTCTGA
Gene >Hirsu2|4873
CTGCTCGACACGCTCGGGTGCGGGCTCGAGGGCCTGCGCTTCCGTGAGTGCGCCAAGCTGCTGGGCCCCGTGGTG
CCGGGGACGGTGGTGCCGAACGGGACGCGGGTGCCGGGGACGCCGTTCGTGCTGGACCCGGTCAACGGGGCGTTC
AACATCGGCACCATGATCCGCTGGCTCGACTTCAACGACTGCTGGCTGGCGGCCGAGTGGGGCCACCCGTCGGAC
AACCTGGGCGCCATCCTGGCCGTGGCCGACTGGGTCAACCGGACCAACAAGGCCGGCGGCGGCCTGGCCGGCGGG
CGCGTCTTCGCCGTCCGCGACGTGCTCGAGGCCATGATCAAGGCGCACGAGATCCAGGGCTGCCTGGCCCTGCTC
AACTCCTTCAACCGCGTCGGCCTCGACCACGTGGTGCTCGTCAAGGTGGCCAGCACGGCCGTCGTCGCCCGCATG
CTCGGCCTCGACGAGCGCCGCATCGCCGACGCCGTCACCCAGGCCTGGGTCGACGGCCAGAGCCTGCGCACCTAC
CGCCACTCGCCCAACACCATGTCGCGCAAGTCGTGGGCCGCCGGCGACGCCTGCCAGCGCGCCGTCAACCTCGCC
CTCAAGGTCATGAAGGGCGAGAGCGGCATCCCGACCGTCCTGTCCGCCCCCGTCTGGGGCTTCTACGACGTCCTC
TTCAAGGGCAACAAGTTTGACTTTCAGCGCCCCTACGGCAGCTACGTCATGGAGAATGTCCTCTTCAAGGTCTCC
TATCCGGGTAACTTGACTCTCTCCTCCTTCTGTCCTGCCCCCCCCCCCCTGACTGACGTGGGCCGCCCCGACCAC
AGCCGAGTTCCACTCGCAGACGGCCGTCGAGGCCTCGGAGAAGATCCACAAGCAGCTCAAGGCCATGGGCAAGTC
GGCGGCCGACATCAAGGCCGTGACGTGCCGCACGCACGAGGCCTGCATCCGCATCATCGACAAGCAGTTCAAGCC
CATGGACAACTTCGCCGACCGCGACCACTGCATCCAGTACATGTGCGCCGTCATGCTCGTCTTCGGCCGGCTCGA
GGCCTCCGACTACGTCGACGGCGGCGAGGCCGCCACCTCGCCGCTCGTCGAGTCGCTGCGCCAGAAGATCCGCTG
CGTCGAGGACGGCCAGTACACGCGCGACTACCACGACCCCAAGCTGCGCACCATCTCCAACGCGCTGACCGTCGA
GCTCAACGACGGCACCCGCCTCGACGAGGTGGCCGTCGAGGCGCCCCTCGGCCACCGCCTGCGCCGCGACGAGGC
CAAGCCCGTCATCCTGGCCAAGTACAAGCGCCACCTGGGCCCGCACCTGCCCGAGAGCAGGGTCAAGGAGCTGGT
CGAGCTCGGCGTCGACGCCAACAGGCTCGACTCGATGCCCGTCGACGAGTACGTCGACCTGTACACCGTCAAGGA
GAGCAAGTTCGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail