Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4859
Gene name
LocationContig_2446:1086..2537
Strand-
Gene length (bp)1451
Transcript length (bp)1392
Coding sequence length (bp)1392
Protein length (aa) 464

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00012 HSP70 Hsp70 protein 8.8E-184 1 444
PF06723 MreB_Mbl MreB/Mbl protein 3.6E-13 5 206

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78695|GRP78_NEUCR 78 kDa glucose-regulated protein homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=grp78 PE=3 SV=3 1 463 0.0E+00
sp|P83616|GRP78_ASPNG 78 kDa glucose-regulated protein homolog OS=Aspergillus niger GN=bipA PE=2 SV=1 1 463 0.0E+00
sp|P83617|GRP78_ASPKA 78 kDa glucose-regulated protein homolog OS=Aspergillus kawachii GN=bipA PE=3 SV=1 1 463 0.0E+00
sp|P59769|GRP78_ASPAW 78 kDa glucose-regulated protein homolog OS=Aspergillus awamori GN=bipA PE=2 SV=1 1 463 0.0E+00
sp|Q99170|GRP78_YARLI 78 kDa glucose-regulated protein homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=KAR2 PE=3 SV=1 1 463 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78695|GRP78_NEUCR 78 kDa glucose-regulated protein homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=grp78 PE=3 SV=3 1 463 0.0E+00
sp|P83616|GRP78_ASPNG 78 kDa glucose-regulated protein homolog OS=Aspergillus niger GN=bipA PE=2 SV=1 1 463 0.0E+00
sp|P83617|GRP78_ASPKA 78 kDa glucose-regulated protein homolog OS=Aspergillus kawachii GN=bipA PE=3 SV=1 1 463 0.0E+00
sp|P59769|GRP78_ASPAW 78 kDa glucose-regulated protein homolog OS=Aspergillus awamori GN=bipA PE=2 SV=1 1 463 0.0E+00
sp|Q99170|GRP78_YARLI 78 kDa glucose-regulated protein homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=KAR2 PE=3 SV=1 1 463 0.0E+00
sp|P16474|GRP78_YEAST 78 kDa glucose-regulated protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAR2 PE=1 SV=1 1 452 0.0E+00
sp|Q75C78|GRP78_ASHGO 78 kDa glucose-regulated protein homolog OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KAR2 PE=3 SV=1 1 447 0.0E+00
sp|P36604|GRP78_SCHPO 78 kDa glucose-regulated protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bip1 PE=3 SV=2 1 443 0.0E+00
sp|Q9HG01|GRP78_PICAN 78 kDa glucose-regulated protein homolog OS=Pichia angusta GN=BiP PE=3 SV=1 1 443 0.0E+00
sp|Q6BZH1|GRP78_DEBHA 78 kDa glucose-regulated protein homolog OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=KAR2 PE=3 SV=1 1 443 0.0E+00
sp|Q6FW50|GRP78_CANGA 78 kDa glucose-regulated protein homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=KAR2 PE=3 SV=1 1 448 0.0E+00
sp|Q0VCX2|GRP78_BOVIN 78 kDa glucose-regulated protein OS=Bos taurus GN=HSPA5 PE=2 SV=1 1 463 0.0E+00
sp|Q90593|GRP78_CHICK 78 kDa glucose-regulated protein OS=Gallus gallus GN=HSPA5 PE=1 SV=1 1 463 0.0E+00
sp|P20029|GRP78_MOUSE 78 kDa glucose-regulated protein OS=Mus musculus GN=Hspa5 PE=1 SV=3 1 463 0.0E+00
sp|P06761|GRP78_RAT 78 kDa glucose-regulated protein OS=Rattus norvegicus GN=Hspa5 PE=1 SV=1 1 463 0.0E+00
sp|P11021|GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 1 463 0.0E+00
sp|P07823|GRP78_MESAU 78 kDa glucose-regulated protein OS=Mesocricetus auratus GN=HSPA5 PE=1 SV=1 1 463 0.0E+00
sp|P19208|HSP7C_CAEBR Heat shock 70 kDa protein C OS=Caenorhabditis briggsae GN=hsp-3 PE=3 SV=2 1 463 0.0E+00
sp|Q5R4P0|GRP78_PONAB 78 kDa glucose-regulated protein OS=Pongo abelii GN=HSPA5 PE=2 SV=1 1 463 0.0E+00
sp|Q3S4T7|GRP78_ICTTR 78 kDa glucose-regulated protein OS=Ictidomys tridecemlineatus GN=HSPA5 PE=2 SV=1 1 463 0.0E+00
sp|P27420|HSP7C_CAEEL Heat shock 70 kDa protein C OS=Caenorhabditis elegans GN=hsp-3 PE=3 SV=2 1 463 0.0E+00
sp|Q91883|GRP78_XENLA 78 kDa glucose-regulated protein OS=Xenopus laevis GN=hspa5 PE=2 SV=1 1 448 0.0E+00
sp|P22010|GRP78_KLULA 78 kDa glucose-regulated protein homolog OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GRP78 PE=3 SV=1 1 447 0.0E+00
sp|Q16956|GRP78_APLCA 78 kDa glucose-regulated protein OS=Aplysia californica PE=1 SV=1 1 448 0.0E+00
sp|P29844|HSP7C_DROME Heat shock 70 kDa protein cognate 3 OS=Drosophila melanogaster GN=Hsc70-3 PE=2 SV=2 1 463 0.0E+00
sp|Q24895|GRP78_ECHMU 78 kDa glucose-regulated protein OS=Echinococcus multilocularis GN=GRP78 PE=2 SV=1 1 455 0.0E+00
sp|P49118|BIP_SOLLC Luminal-binding protein OS=Solanum lycopersicum PE=2 SV=1 1 463 0.0E+00
sp|Q24798|GRP78_ECHGR 78 kDa glucose-regulated protein OS=Echinococcus granulosus GN=GRP78 PE=2 SV=1 1 455 0.0E+00
sp|Q03685|BIP5_TOBAC Luminal-binding protein 5 OS=Nicotiana tabacum GN=BIP5 PE=2 SV=1 1 463 0.0E+00
sp|P20163|HSP7D_CAEEL Heat shock 70 kDa protein D OS=Caenorhabditis elegans GN=hsp-4 PE=1 SV=2 1 463 0.0E+00
sp|Q03684|BIP4_TOBAC Luminal-binding protein 4 OS=Nicotiana tabacum GN=BIP4 PE=2 SV=1 1 463 0.0E+00
sp|Q42434|BIP_SPIOL Luminal-binding protein OS=Spinacia oleracea GN=HSC70 PE=2 SV=1 1 463 0.0E+00
sp|Q39043|MD37F_ARATH Mediator of RNA polymerase II transcription subunit 37f OS=Arabidopsis thaliana GN=MED37F PE=1 SV=2 1 452 0.0E+00
sp|Q9LKR3|MD37A_ARATH Mediator of RNA polymerase II transcription subunit 37a OS=Arabidopsis thaliana GN=MED37A PE=1 SV=1 1 444 0.0E+00
sp|P27322|HSP72_SOLLC Heat shock cognate 70 kDa protein 2 OS=Solanum lycopersicum GN=HSC-2 PE=2 SV=1 1 449 0.0E+00
sp|P09189|HSP7C_PETHY Heat shock cognate 70 kDa protein OS=Petunia hybrida GN=HSP70 PE=2 SV=1 1 457 0.0E+00
sp|O24581|BIP3_MAIZE Luminal-binding protein 3 OS=Zea mays GN=BIPE3 PE=2 SV=1 1 444 0.0E+00
sp|P24067|BIP2_MAIZE Luminal-binding protein 2 OS=Zea mays GN=BIPE2 PE=1 SV=3 1 444 0.0E+00
sp|Q9LHA8|MD37C_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37C PE=1 SV=1 1 447 0.0E+00
sp|O59855|HSP72_SCHPO Probable heat shock protein ssa2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssa2 PE=1 SV=3 1 444 0.0E+00
sp|Q71U34|HSP7C_SAGOE Heat shock cognate 71 kDa protein OS=Saguinus oedipus GN=HSPA8 PE=2 SV=1 1 444 0.0E+00
sp|P11142|HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 1 444 0.0E+00
sp|A2Q0Z1|HSP7C_HORSE Heat shock cognate 71 kDa protein OS=Equus caballus GN=HSPA8 PE=2 SV=1 1 444 0.0E+00
sp|P26413|HSP70_SOYBN Heat shock 70 kDa protein OS=Glycine max GN=HSP70 PE=3 SV=1 1 450 0.0E+00
sp|Q90473|HSP7C_DANRE Heat shock cognate 71 kDa protein OS=Danio rerio GN=hspa8 PE=2 SV=1 1 446 0.0E+00
sp|P19120|HSP7C_BOVIN Heat shock cognate 71 kDa protein OS=Bos taurus GN=HSPA8 PE=1 SV=2 1 444 0.0E+00
sp|P63018|HSP7C_RAT Heat shock cognate 71 kDa protein OS=Rattus norvegicus GN=Hspa8 PE=1 SV=1 1 444 0.0E+00
sp|P63017|HSP7C_MOUSE Heat shock cognate 71 kDa protein OS=Mus musculus GN=Hspa8 PE=1 SV=1 1 444 0.0E+00
sp|Q5NVM9|HSP7C_PONAB Heat shock cognate 71 kDa protein OS=Pongo abelii GN=HSPA8 PE=2 SV=2 1 444 0.0E+00
sp|P22953|MD37E_ARATH Probable mediator of RNA polymerase II transcription subunit 37e OS=Arabidopsis thaliana GN=MED37E PE=1 SV=3 1 444 0.0E+00
sp|Q01233|HSP70_NEUCR Heat shock 70 kDa protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hsps-1 PE=2 SV=2 1 443 0.0E+00
sp|P41753|HSP70_ACHKL Heat shock 70 kDa protein OS=Achlya klebsiana GN=HSP70 PE=2 SV=1 1 443 0.0E+00
sp|Q8T869|BIP2_DICDI Luminal-binding protein 2 OS=Dictyostelium discoideum GN=bip2 PE=1 SV=1 1 463 0.0E+00
sp|Q01877|HSP71_PUCGR Heat shock protein HSS1 OS=Puccinia graminis GN=HSS1 PE=3 SV=1 1 443 0.0E+00
sp|Q10265|HSP71_SCHPO Probable heat shock protein ssa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssa1 PE=1 SV=2 1 444 0.0E+00
sp|Q96W30|HSP72_PARBA Heat shock 70 kDa protein 2 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=HSP70-2 PE=2 SV=2 1 443 0.0E+00
sp|P19378|HSP7C_CRIGR Heat shock cognate 71 kDa protein OS=Cricetulus griseus GN=HSPA8 PE=2 SV=1 1 444 0.0E+00
sp|O73885|HSP7C_CHICK Heat shock cognate 71 kDa protein OS=Gallus gallus GN=HSPA8 PE=1 SV=1 1 444 0.0E+00
sp|A5A8V7|HS71L_PIG Heat shock 70 kDa protein 1-like OS=Sus scrofa GN=HSPA1L PE=2 SV=1 1 445 0.0E+00
sp|Q4R888|HS71L_MACFA Heat shock 70 kDa protein 1-like OS=Macaca fascicularis GN=HSPA1L PE=2 SV=1 1 452 0.0E+00
sp|Q27975|HS71A_BOVIN Heat shock 70 kDa protein 1A OS=Bos taurus GN=HSPA1A PE=1 SV=2 1 443 0.0E+00
sp|Q27965|HS71B_BOVIN Heat shock 70 kDa protein 1B OS=Bos taurus GN=HSPA1B PE=2 SV=1 1 443 0.0E+00
sp|P22954|MD37D_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37D PE=1 SV=2 1 444 0.0E+00
sp|Q5R7D3|HSP71_PONAB Heat shock 70 kDa protein 1 OS=Pongo abelii GN=HSPA1 PE=2 SV=1 1 443 0.0E+00
sp|P0DMV9|HS71B_HUMAN Heat shock 70 kDa protein 1B OS=Homo sapiens GN=HSPA1B PE=1 SV=1 1 443 0.0E+00
sp|P0DMV8|HS71A_HUMAN Heat shock 70 kDa protein 1A OS=Homo sapiens GN=HSPA1A PE=1 SV=1 1 443 0.0E+00
sp|Q4U0F3|HS71B_BOSMU Heat shock 70 kDa protein 1B OS=Bos mutus grunniens GN=HSPA1B PE=2 SV=1 1 443 0.0E+00
sp|P55063|HS71L_RAT Heat shock 70 kDa protein 1-like OS=Rattus norvegicus GN=Hspa1l PE=2 SV=2 1 452 0.0E+00
sp|P24629|HSP71_SOLLC Heat shock cognate 70 kDa protein 1 OS=Solanum lycopersicum GN=HSC-I PE=2 SV=1 1 450 0.0E+00
sp|P34931|HS71L_HUMAN Heat shock 70 kDa protein 1-like OS=Homo sapiens GN=HSPA1L PE=1 SV=2 1 452 0.0E+00
sp|P0CB32|HS71L_BOVIN Heat shock 70 kDa protein 1-like OS=Bos taurus GN=HSPA1L PE=3 SV=1 1 445 0.0E+00
sp|O65719|HSP7C_ARATH Heat shock 70 kDa protein 3 OS=Arabidopsis thaliana GN=HSP70-3 PE=1 SV=1 1 444 0.0E+00
sp|Q6S4N2|HS71B_PIG Heat shock 70 kDa protein 1B OS=Sus scrofa GN=HSPA1B PE=2 SV=1 1 443 0.0E+00
sp|P09446|HSP7A_CAEEL Heat shock 70 kDa protein A OS=Caenorhabditis elegans GN=hsp-1 PE=1 SV=2 1 444 0.0E+00
sp|P16627|HS71L_MOUSE Heat shock 70 kDa protein 1-like OS=Mus musculus GN=Hspa1l PE=1 SV=4 1 444 0.0E+00
sp|P08108|HSP70_ONCMY Heat shock cognate 70 kDa protein OS=Oncorhynchus mykiss GN=hsc71 PE=2 SV=2 1 444 0.0E+00
sp|Q9S9N1|HSP7E_ARATH Heat shock 70 kDa protein 5 OS=Arabidopsis thaliana GN=HSP70-5 PE=2 SV=1 1 459 0.0E+00
sp|P0DMW1|HS71B_RAT Heat shock 70 kDa protein 1B OS=Rattus norvegicus GN=Hspa1a PE=2 SV=1 1 443 0.0E+00
sp|P0DMW0|HS71A_RAT Heat shock 70 kDa protein 1A OS=Rattus norvegicus GN=Hspa1a PE=2 SV=1 1 443 0.0E+00
sp|P34930|HS71A_PIG Heat shock 70 kDa protein 1A OS=Sus scrofa GN=HSPA1A PE=3 SV=1 1 444 0.0E+00
sp|Q7YQC6|HSP71_CANLF Heat shock 70 kDa protein 1 OS=Canis lupus familiaris GN=HSPA1 PE=2 SV=1 1 443 0.0E+00
sp|Q61696|HS71A_MOUSE Heat shock 70 kDa protein 1A OS=Mus musculus GN=Hspa1a PE=1 SV=2 1 455 0.0E+00
sp|Q91233|HSP70_ONCTS Heat shock 70 kDa protein OS=Oncorhynchus tshawytscha GN=hsp70 PE=2 SV=1 1 447 0.0E+00
sp|P17879|HS71B_MOUSE Heat shock 70 kDa protein 1B OS=Mus musculus GN=Hspa1b PE=1 SV=3 1 443 0.0E+00
sp|P47773|HSP7C_ICTPU Heat shock cognate 71 kDa protein OS=Ictalurus punctatus GN=hsc70 PE=2 SV=1 1 444 0.0E+00
sp|P11143|HSP70_MAIZE Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=3 SV=2 1 445 0.0E+00
sp|Q9U639|HSP7D_MANSE Heat shock 70 kDa protein cognate 4 OS=Manduca sexta PE=2 SV=1 1 444 0.0E+00
sp|P08418|HSP70_SCHMA Heat shock 70 kDa protein homolog OS=Schistosoma mansoni PE=2 SV=2 1 454 0.0E+00
sp|Q9I8F9|HSP71_ORYLA Heat shock 70 kDa protein 1 OS=Oryzias latipes PE=3 SV=1 1 455 0.0E+00
sp|Q5B2V1|HSP70_EMENI Heat shock 70 kDa protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hsp70 PE=1 SV=1 1 440 0.0E+00
sp|P22202|HSP74_YEAST Heat shock protein SSA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA4 PE=1 SV=3 1 443 0.0E+00
sp|Q92260|HSP70_PENCI Heat shock 70 kDa protein (Fragment) OS=Penicillium citrinum GN=HSP70 PE=1 SV=1 1 438 0.0E+00
sp|P29357|HSP7E_SPIOL Chloroplast envelope membrane 70 kDa heat shock-related protein OS=Spinacia oleracea GN=SCE70 PE=1 SV=3 1 446 0.0E+00
sp|P54652|HSP72_HUMAN Heat shock-related 70 kDa protein 2 OS=Homo sapiens GN=HSPA2 PE=1 SV=1 1 444 0.0E+00
sp|Q9TUG3|HSP72_CAPHI Heat shock-related 70 kDa protein 2 OS=Capra hircus GN=HSPA2 PE=3 SV=1 1 444 0.0E+00
sp|P09435|HSP73_YEAST Heat shock protein SSA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA3 PE=1 SV=3 1 443 0.0E+00
sp|Q8H1B3|MD37B_ARATH Probable mediator of RNA polymerase II transcription subunit 37b OS=Arabidopsis thaliana GN=MED37B PE=1 SV=1 1 444 0.0E+00
sp|P87047|HSP71_PARBA Heat shock 70 kDa protein 1 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=HSP70-1 PE=1 SV=1 1 443 0.0E+00
sp|P10592|HSP72_YEAST Heat shock protein SSA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA2 PE=1 SV=3 1 448 0.0E+00
sp|P14659|HSP72_RAT Heat shock-related 70 kDa protein 2 OS=Rattus norvegicus GN=Hspa2 PE=1 SV=2 1 444 0.0E+00
sp|P17156|HSP72_MOUSE Heat shock-related 70 kDa protein 2 OS=Mus musculus GN=Hspa2 PE=1 SV=2 1 444 0.0E+00
sp|P10591|HSP71_YEAST Heat shock protein SSA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA1 PE=1 SV=4 1 444 0.0E+00
sp|O93866|HSP70_TRIRU Heat shock 70 kDa protein OS=Trichophyton rubrum GN=HSP70 PE=2 SV=1 1 443 0.0E+00
sp|P34933|HSP72_BOVIN Heat shock-related 70 kDa protein 2 OS=Bos taurus GN=HSPA2 PE=2 SV=2 1 444 0.0E+00
sp|P46587|HSP72_CANAL Heat shock protein SSA2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSA2 PE=1 SV=3 1 445 0.0E+00
sp|P11145|HSP74_TRYBB Heat shock 70 kDa protein 4 OS=Trypanosoma brucei brucei PE=2 SV=2 1 444 0.0E+00
sp|P11147|HSP7D_DROME Heat shock 70 kDa protein cognate 4 OS=Drosophila melanogaster GN=Hsc70-4 PE=1 SV=3 1 444 0.0E+00
sp|P02827|HSP70_XENLA Heat shock 70 kDa protein OS=Xenopus laevis PE=2 SV=1 1 444 0.0E+00
sp|Q05866|GRP78_PLAFO 78 kDa glucose-regulated protein homolog OS=Plasmodium falciparum (isolate NF54) PE=3 SV=1 1 448 0.0E+00
sp|P48720|HSP70_BLAEM Heat shock 70 kDa protein OS=Blastocladiella emersonii GN=HSP70 PE=3 SV=1 1 443 0.0E+00
sp|P18694|HSP72_USTMA Heat shock 70 kDa protein 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMS2 PE=3 SV=2 1 443 0.0E+00
sp|P37899|HSP70_PYRSA Heat shock 70 kDa protein OS=Pyrenomonas salina GN=HSP70 PE=3 SV=1 1 444 0.0E+00
sp|P36415|HS7C1_DICDI Heat shock cognate 70 kDa protein 1 OS=Dictyostelium discoideum GN=hspB PE=1 SV=2 1 444 0.0E+00
sp|P25840|HSP70_CHLRE Heat shock 70 kDa protein OS=Chlamydomonas reinhardtii GN=HSP70 PE=2 SV=2 1 444 0.0E+00
sp|Q07437|HSP70_LEIAM Heat shock 70 kDa protein OS=Leishmania amazonensis GN=HSP70 PE=2 SV=1 1 444 0.0E+00
sp|P27541|HSP70_BRUMA Heat shock 70 kDa protein OS=Brugia malayi GN=HSP70 PE=3 SV=1 1 444 0.0E+00
sp|Q9C7X7|HSP7N_ARATH Heat shock 70 kDa protein 18 OS=Arabidopsis thaliana GN=HSP70-18 PE=2 SV=1 1 445 0.0E+00
sp|P53623|HSP72_PICAN Heat shock protein 70 2 OS=Pichia angusta GN=HSA2 PE=3 SV=2 1 443 0.0E+00
sp|P29843|HSP7A_DROME Heat shock 70 kDa protein cognate 1 OS=Drosophila melanogaster GN=Hsc70-1 PE=1 SV=1 1 447 0.0E+00
sp|P05456|HSP70_TRYCR Heat shock 70 kDa protein OS=Trypanosoma cruzi GN=HSP70 PE=3 SV=1 1 444 0.0E+00
sp|Q9W6Y1|HSP7C_ORYLA Heat shock cognate 71 kDa protein OS=Oryzias latipes GN=hsc70 PE=2 SV=1 1 456 0.0E+00
sp|P41797|HSP71_CANAL Heat shock protein SSA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSA1 PE=1 SV=2 1 440 0.0E+00
sp|P40918|HSP70_DAVTA Heat shock 70 kDa protein OS=Davidiella tassiana GN=HSP70 PE=1 SV=1 1 448 0.0E+00
sp|P08106|HSP70_CHICK Heat shock 70 kDa protein OS=Gallus gallus PE=1 SV=1 1 444 0.0E+00
sp|P41827|HSP74_ANOAL Heat shock protein 70 B2 OS=Anopheles albimanus GN=HSP70B2 PE=3 SV=1 1 448 0.0E+00
sp|Q24789|HSP70_ECHGR Heat shock cognate 70 kDa protein OS=Echinococcus granulosus GN=HSP70 PE=2 SV=1 1 446 0.0E+00
sp|P53421|HSP71_PICAN Heat shock protein 70 1 OS=Pichia angusta GN=HSA1 PE=1 SV=2 1 443 0.0E+00
sp|P41825|HSP71_ANOAL Heat shock protein 70 A1 OS=Anopheles albimanus GN=HSP70A1 PE=3 SV=1 1 448 0.0E+00
sp|P41826|HSP72_ANOAL Heat shock protein 70 A2 OS=Anopheles albimanus GN=HSP70A2 PE=3 SV=1 1 448 0.0E+00
sp|Q557E0|HS7C2_DICDI Heat shock cognate 70 kDa protein 2 OS=Dictyostelium discoideum GN=hspE-1 PE=1 SV=1 1 449 0.0E+00
sp|P17804|HSP70_LEIDO Heat shock 70 kDa protein OS=Leishmania donovani GN=HSP70 PE=3 SV=1 1 444 0.0E+00
sp|P11144|HSP70_PLAFA Heat shock 70 kDa protein OS=Plasmodium falciparum PE=2 SV=2 1 444 0.0E+00
sp|Q9BIR7|HSP75_DROME Major heat shock 70 kDa protein Bc OS=Drosophila melanogaster GN=Hsp70Bc PE=2 SV=2 1 444 0.0E+00
sp|Q9BIS2|HSP73_DROME Major heat shock 70 kDa protein Bb OS=Drosophila melanogaster GN=Hsp70Bb PE=2 SV=2 1 444 0.0E+00
sp|Q8INI8|HSP72_DROME Major heat shock 70 kDa protein Ba OS=Drosophila melanogaster GN=Hsp70Ba PE=2 SV=2 1 444 0.0E+00
sp|Q9VG58|HSP74_DROME Major heat shock 70 kDa protein Bbb OS=Drosophila melanogaster GN=Hsp70Bbb PE=3 SV=2 1 444 0.0E+00
sp|P17066|HSP76_HUMAN Heat shock 70 kDa protein 6 OS=Homo sapiens GN=HSPA6 PE=1 SV=2 1 443 0.0E+00
sp|Q9GSU4|HSP72_DROSI Major heat shock 70 kDa protein Ba OS=Drosophila simulans GN=Hsp70Ba PE=3 SV=2 1 444 0.0E+00
sp|Q04967|HSP76_PIG Heat shock 70 kDa protein 6 OS=Sus scrofa GN=HSPA6 PE=2 SV=1 1 452 0.0E+00
sp|Q05746|HSP70_PLACB Heat shock 70 kDa protein OS=Plasmodium cynomolgi (strain Berok) PE=2 SV=1 1 444 0.0E+00
sp|Q9N1U2|HSP76_SAGOE Heat shock 70 kDa protein 6 OS=Saguinus oedipus GN=HSPA6 PE=2 SV=1 1 443 0.0E+00
sp|P02825|HSP71_DROME Major heat shock 70 kDa protein Ab OS=Drosophila melanogaster GN=Hsp70Ab PE=2 SV=3 1 444 0.0E+00
sp|P82910|HSP70_DROME Major heat shock 70 kDa protein Aa OS=Drosophila melanogaster GN=Hsp70Aa PE=2 SV=2 1 444 0.0E+00
sp|Q54BE0|HS7C3_DICDI Heat shock cognate 70 kDa protein 3 OS=Dictyostelium discoideum GN=DDB_G0293674 PE=3 SV=1 1 445 0.0E+00
sp|Q9GSU7|HSP71_DROSI Major heat shock 70 kDa protein Ab OS=Drosophila simulans GN=Hsp70Ab PE=3 SV=2 1 444 0.0E+00
sp|Q05944|HSP70_HYDVU Heat shock 70 kDa protein OS=Hydra vulgaris GN=HSP70.1 PE=3 SV=1 1 445 0.0E+00
sp|O97125|HSP68_DROME Heat shock protein 68 OS=Drosophila melanogaster GN=Hsp68 PE=1 SV=1 1 450 0.0E+00
sp|P16394|HSP70_BRELC Heat shock 70 kDa protein OS=Bremia lactucae GN=HSP70 PE=3 SV=1 1 443 0.0E+00
sp|Q00043|HSP70_AJECA Heat shock 70 kDa protein OS=Ajellomyces capsulatus GN=HSP70 PE=3 SV=1 1 449 0.0E+00
sp|Q91291|HSP70_PLEWA Heat shock 70 kDa protein OS=Pleurodeles waltl GN=HSP70 PE=2 SV=1 1 444 0.0E+00
sp|Q28222|HSP71_CHLAE Heat shock 70 kDa protein 1 OS=Chlorocebus aethiops GN=HSPA1 PE=2 SV=1 1 444 1.0E-180
sp|P26791|HSP70_DAUCA Heat shock 70 kDa protein OS=Daucus carota GN=HSP70 PE=3 SV=1 1 447 2.0E-177
sp|Q06248|HSP74_PARLI Heat shock 70 kDa protein IV OS=Paracentrotus lividus GN=HSP70IV PE=3 SV=1 1 443 6.0E-175
sp|P11146|HSP7B_DROME Heat shock 70 kDa protein cognate 2 OS=Drosophila melanogaster GN=Hsc70-2 PE=1 SV=2 1 451 1.0E-174
sp|Q27031|HSP70_THEPA Heat shock 70 kDa protein OS=Theileria parva GN=TP02_0148 PE=2 SV=2 1 459 1.0E-174
sp|P16019|HSP70_THEAN Heat shock 70 kDa protein OS=Theileria annulata GN=TA11610 PE=3 SV=2 1 451 3.0E-172
sp|P91902|HSP70_CERCA Heat shock protein 70 OS=Ceratitis capitata PE=2 SV=1 1 443 6.0E-161
sp|Q5UQ49|HSP70_MIMIV Heat shock 70 kDa protein homolog OS=Acanthamoeba polyphaga mimivirus GN=HSP70 PE=3 SV=1 1 443 5.0E-156
sp|P14834|HSP70_LEIMA Heat shock 70 kDa protein (Fragment) OS=Leishmania major GN=HSP70 PE=3 SV=1 1 343 7.0E-155
sp|P30721|DNAK_CLOAB Chaperone protein DnaK OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dnaK PE=2 SV=3 1 451 3.0E-149
sp|Q8DI58|DNAK2_THEEB Chaperone protein dnaK2 OS=Thermosynechococcus elongatus (strain BP-1) GN=dnaK2 PE=3 SV=1 1 446 8.0E-149
sp|A3DF25|DNAK_CLOTH Chaperone protein DnaK OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=dnaK PE=3 SV=1 1 461 1.0E-148
sp|P50021|DNAK2_SYNE7 Chaperone protein dnaK2 OS=Synechococcus elongatus (strain PCC 7942) GN=dnaK2 PE=3 SV=2 1 457 3.0E-148
sp|Q7NDH1|DNAK_GLOVI Chaperone protein DnaK OS=Gloeobacter violaceus (strain PCC 7421) GN=dnaK PE=3 SV=1 1 452 3.0E-148
sp|A7Z6W1|DNAK_BACMF Chaperone protein DnaK OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dnaK PE=3 SV=1 1 455 1.0E-147
sp|A6LRN4|DNAK_CLOB8 Chaperone protein DnaK OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=dnaK PE=3 SV=1 1 452 2.0E-147
sp|Q5N1J4|DNAK2_SYNP6 Chaperone protein DnaK 2 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=dnaK2 PE=3 SV=1 1 457 3.0E-147
sp|Q04EE1|DNAK_OENOB Chaperone protein DnaK OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=dnaK PE=3 SV=1 1 457 3.0E-147
sp|B7GKC8|DNAK_ANOFW Chaperone protein DnaK OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=dnaK PE=3 SV=1 1 444 4.0E-147
sp|B0K3Y0|DNAK_THEPX Chaperone protein DnaK OS=Thermoanaerobacter sp. (strain X514) GN=dnaK PE=3 SV=1 1 449 8.0E-147
sp|Q85FW4|DNAK_CYAME Chaperone protein dnaK OS=Cyanidioschyzon merolae GN=dnaK PE=3 SV=1 1 423 3.0E-146
sp|Q2LUH6|DNAK_SYNAS Chaperone protein DnaK OS=Syntrophus aciditrophicus (strain SB) GN=dnaK PE=3 SV=1 1 440 4.0E-146
sp|Q9UXR0|DNAK_METTE Chaperone protein DnaK OS=Methanosarcina thermophila GN=dnaK PE=3 SV=1 1 444 8.0E-146
sp|Q8RB68|DNAK_CALS4 Chaperone protein DnaK OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dnaK PE=3 SV=1 1 448 8.0E-146
sp|Q93R27|DNAK_TETHA Chaperone protein DnaK OS=Tetragenococcus halophilus GN=dnaK PE=3 SV=1 1 458 8.0E-146
sp|A0Q1R4|DNAK_CLONN Chaperone protein DnaK OS=Clostridium novyi (strain NT) GN=dnaK PE=3 SV=1 1 449 1.0E-145
sp|B0KA81|DNAK_THEP3 Chaperone protein DnaK OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=dnaK PE=3 SV=1 1 449 1.0E-145
sp|Q5WHG1|DNAK_BACSK Chaperone protein DnaK OS=Bacillus clausii (strain KSM-K16) GN=dnaK PE=3 SV=1 1 444 1.0E-145
sp|B2TLZ7|DNAK_CLOBB Chaperone protein DnaK OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=dnaK PE=3 SV=1 1 449 2.0E-145
sp|B3WEQ7|DNAK_LACCB Chaperone protein DnaK OS=Lactobacillus casei (strain BL23) GN=dnaK PE=3 SV=1 1 446 2.0E-145
sp|Q038N3|DNAK_LACC3 Chaperone protein DnaK OS=Lactobacillus casei (strain ATCC 334) GN=dnaK PE=3 SV=1 1 446 2.0E-145
sp|Q9KD72|DNAK_BACHD Chaperone protein DnaK OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=dnaK PE=3 SV=3 1 444 3.0E-145
sp|P17820|DNAK_BACSU Chaperone protein DnaK OS=Bacillus subtilis (strain 168) GN=dnaK PE=1 SV=3 1 452 3.0E-145
sp|Q9XCB1|DNAK_RHOMR Chaperone protein DnaK OS=Rhodothermus marinus GN=dnaK PE=3 SV=1 1 449 6.0E-145
sp|Q0SRE3|DNAK_CLOPS Chaperone protein DnaK OS=Clostridium perfringens (strain SM101 / Type A) GN=dnaK PE=3 SV=1 1 450 1.0E-144
sp|Q2RKX4|DNAK_MOOTA Chaperone protein DnaK OS=Moorella thermoacetica (strain ATCC 39073) GN=dnaK PE=3 SV=1 1 443 1.0E-144
sp|B5YH59|DNAK_THEYD Chaperone protein DnaK OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=dnaK PE=3 SV=1 1 456 1.0E-144
sp|B2V2I5|DNAK_CLOBA Chaperone protein DnaK OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=dnaK PE=3 SV=1 1 449 2.0E-144
sp|Q3AF08|DNAK_CARHZ Chaperone protein DnaK OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=dnaK PE=3 SV=1 1 444 2.0E-144
sp|P0CW12|DNAK_METMZ Chaperone protein DnaK OS=Methanosarcina mazei GN=dnaK PE=3 SV=1 1 443 2.0E-144
sp|P0CW13|DNAK_METMA Chaperone protein DnaK OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=dnaK PE=3 SV=1 1 443 2.0E-144
sp|B9DNK0|DNAK_STACT Chaperone protein DnaK OS=Staphylococcus carnosus (strain TM300) GN=dnaK PE=3 SV=1 1 461 2.0E-144
sp|Q4L6T0|DNAK_STAHJ Chaperone protein DnaK OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dnaK PE=3 SV=1 1 443 2.0E-144
sp|Q49Y22|DNAK_STAS1 Chaperone protein DnaK OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=dnaK PE=3 SV=1 1 461 3.0E-144
sp|Q892R0|DNAK_CLOTE Chaperone protein DnaK OS=Clostridium tetani (strain Massachusetts / E88) GN=dnaK PE=3 SV=1 1 451 4.0E-144
sp|Q6CQ83|HSP75_KLULA Heat shock protein SSB OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SSB PE=3 SV=3 1 424 4.0E-144
sp|A5N6M2|DNAK_CLOK5 Chaperone protein DnaK OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=dnaK PE=3 SV=1 1 452 5.0E-144
sp|B9E041|DNAK_CLOK1 Chaperone protein DnaK OS=Clostridium kluyveri (strain NBRC 12016) GN=dnaK PE=3 SV=1 1 452 5.0E-144
sp|A4J7F3|DNAK_DESRM Chaperone protein DnaK OS=Desulfotomaculum reducens (strain MI-1) GN=dnaK PE=3 SV=1 1 443 5.0E-144
sp|Q465Y6|DNAK_METBF Chaperone protein DnaK OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=dnaK PE=3 SV=1 1 443 5.0E-144
sp|B1KZN7|DNAK_CLOBM Chaperone protein DnaK OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=dnaK PE=3 SV=1 1 451 9.0E-144
sp|Q876N3|HSP75_CANGA Heat shock protein SSB OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SSB1 PE=3 SV=3 1 385 1.0E-143
sp|P38646|GRP75_HUMAN Stress-70 protein, mitochondrial OS=Homo sapiens GN=HSPA9 PE=1 SV=2 1 456 1.0E-143
sp|Q88VM0|DNAK_LACPL Chaperone protein DnaK OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dnaK PE=3 SV=1 1 443 1.0E-143
sp|B9IY81|DNAK_BACCQ Chaperone protein DnaK OS=Bacillus cereus (strain Q1) GN=dnaK PE=3 SV=1 1 443 2.0E-143
sp|B7HPL3|DNAK_BACC7 Chaperone protein DnaK OS=Bacillus cereus (strain AH187) GN=dnaK PE=3 SV=1 1 443 2.0E-143
sp|Q730M1|DNAK_BACC1 Chaperone protein DnaK OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dnaK PE=3 SV=1 1 443 2.0E-143
sp|O35501|GRP75_CRIGR Stress-70 protein, mitochondrial OS=Cricetulus griseus GN=HSPA9 PE=2 SV=1 1 456 2.0E-143
sp|A8FFD2|DNAK_BACP2 Chaperone protein DnaK OS=Bacillus pumilus (strain SAFR-032) GN=dnaK PE=3 SV=1 1 456 2.0E-143
sp|Q5KWZ7|DNAK_GEOKA Chaperone protein DnaK OS=Geobacillus kaustophilus (strain HTA426) GN=dnaK PE=1 SV=1 1 461 2.0E-143
sp|Q5YNI0|DNAK_NOCFA Chaperone protein DnaK OS=Nocardia farcinica (strain IFM 10152) GN=dnaK PE=3 SV=1 1 387 3.0E-143
sp|Q5R511|GRP75_PONAB Stress-70 protein, mitochondrial OS=Pongo abelii GN=HSPA9 PE=2 SV=1 1 456 3.0E-143
sp|A0AIS4|DNAK_LISW6 Chaperone protein DnaK OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dnaK PE=3 SV=1 1 443 3.0E-143
sp|B1MIX5|DNAK_MYCA9 Chaperone protein DnaK OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=dnaK PE=3 SV=1 1 461 3.0E-143
sp|Q3ZCH0|GRP75_BOVIN Stress-70 protein, mitochondrial OS=Bos taurus GN=HSPA9 PE=2 SV=1 1 456 5.0E-143
sp|A7GHH6|DNAK_CLOBL Chaperone protein DnaK OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=dnaK PE=3 SV=1 1 451 5.0E-143
sp|C1FVU0|DNAK_CLOBJ Chaperone protein DnaK OS=Clostridium botulinum (strain Kyoto / Type A2) GN=dnaK PE=3 SV=1 1 451 5.0E-143
sp|A5I640|DNAK_CLOBH Chaperone protein DnaK OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=dnaK PE=3 SV=1 1 451 5.0E-143
sp|A7FXL5|DNAK_CLOB1 Chaperone protein DnaK OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=dnaK PE=3 SV=1 1 451 5.0E-143
sp|B1ILM3|DNAK_CLOBK Chaperone protein DnaK OS=Clostridium botulinum (strain Okra / Type B1) GN=dnaK PE=3 SV=1 1 451 6.0E-143
sp|P22358|DNAK2_SYNY3 Chaperone protein dnaK2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dnaK2 PE=2 SV=1 1 449 7.0E-143
sp|Q8EPW4|DNAK_OCEIH Chaperone protein DnaK OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=dnaK PE=3 SV=1 1 463 8.0E-143
sp|P96133|DNAK_THERP Chaperone protein DnaK OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=dnaK PE=3 SV=2 1 457 9.0E-143
sp|Q5HNW6|DNAK_STAEQ Chaperone protein DnaK OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dnaK PE=3 SV=1 1 443 1.0E-142
sp|P41770|HSP75_KLUMA Heat shock protein SSB OS=Kluyveromyces marxianus GN=SSB PE=3 SV=2 1 424 1.0E-142
sp|C4LGV8|DNAK_CORK4 Chaperone protein DnaK OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=dnaK PE=3 SV=1 1 444 1.0E-142
sp|Q8CP17|DNAK_STAES Chaperone protein DnaK OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dnaK PE=3 SV=1 1 443 2.0E-142
sp|C5D4U1|DNAK_GEOSW Chaperone protein DnaK OS=Geobacillus sp. (strain WCH70) GN=dnaK PE=3 SV=1 1 444 2.0E-142
sp|A4VT29|DNAK_STRSY Chaperone protein DnaK OS=Streptococcus suis (strain 05ZYH33) GN=dnaK PE=3 SV=1 1 436 2.0E-142
sp|A4VZB5|DNAK_STRS2 Chaperone protein DnaK OS=Streptococcus suis (strain 98HAH33) GN=dnaK PE=3 SV=1 1 436 2.0E-142
sp|A6TSM0|DNAK_ALKMQ Chaperone protein DnaK OS=Alkaliphilus metalliredigens (strain QYMF) GN=dnaK PE=3 SV=1 1 443 2.0E-142
sp|A1B4E9|DNAK_PARDP Chaperone protein DnaK OS=Paracoccus denitrificans (strain Pd 1222) GN=dnaK PE=3 SV=1 1 463 2.0E-142
sp|Q9KWS7|DNAK_GEOTM Chaperone protein DnaK OS=Geobacillus thermoglucosidasius GN=dnaK PE=3 SV=3 1 444 3.0E-142
sp|Q707X3|HSP75_ZYGRC Heat shock protein SSB OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=SSB PE=3 SV=3 1 434 3.0E-142
sp|A4T112|DNAK_MYCGI Chaperone protein DnaK OS=Mycobacterium gilvum (strain PYR-GCK) GN=dnaK PE=3 SV=1 1 448 3.0E-142
sp|P26823|DNAK_CLOPE Chaperone protein DnaK OS=Clostridium perfringens (strain 13 / Type A) GN=dnaK PE=3 SV=2 1 443 4.0E-142
sp|Q0TNS7|DNAK_CLOP1 Chaperone protein DnaK OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=dnaK PE=3 SV=1 1 443 4.0E-142
sp|Q6G554|DNAK_BARHE Chaperone protein DnaK OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=dnaK PE=3 SV=1 1 446 4.0E-142
sp|P38647|GRP75_MOUSE Stress-70 protein, mitochondrial OS=Mus musculus GN=Hspa9 PE=1 SV=3 1 456 4.0E-142
sp|A7GT08|DNAK_BACCN Chaperone protein DnaK OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dnaK PE=3 SV=1 1 443 5.0E-142
sp|Q05647|DNAK_ERYRH Chaperone protein DnaK OS=Erysipelothrix rhusiopathiae GN=dnaK PE=3 SV=2 1 450 6.0E-142
sp|P11484|HSP75_YEAST Heat shock protein SSB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSB1 PE=1 SV=3 1 385 7.0E-142
sp|Q3A8C2|DNAK_PELCD Chaperone protein DnaK OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=dnaK PE=3 SV=1 1 462 7.0E-142
sp|A0QQC8|DNAK_MYCS2 Chaperone protein DnaK OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=dnaK PE=1 SV=1 1 448 9.0E-142
sp|Q6G1F9|DNAK_BARQU Chaperone protein DnaK OS=Bartonella quintana (strain Toulouse) GN=dnaK PE=3 SV=1 1 446 9.0E-142
sp|B2IMB5|DNAK_STRPS Chaperone protein DnaK OS=Streptococcus pneumoniae (strain CGSP14) GN=dnaK PE=3 SV=1 1 436 9.0E-142
sp|A5GDC8|DNAK_GEOUR Chaperone protein DnaK OS=Geobacter uraniireducens (strain Rf4) GN=dnaK PE=3 SV=1 1 461 1.0E-141
sp|B9JZ87|DNAK_AGRVS Chaperone protein DnaK OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dnaK PE=3 SV=1 1 462 1.0E-141
sp|A9VHU1|DNAK_BACWK Chaperone protein DnaK OS=Bacillus weihenstephanensis (strain KBAB4) GN=dnaK PE=3 SV=1 1 443 1.0E-141
sp|A6Q421|DNAK_NITSB Chaperone protein DnaK OS=Nitratiruptor sp. (strain SB155-2) GN=dnaK PE=3 SV=1 1 444 1.0E-141
sp|Q84BU4|DNAK_LACAC Chaperone protein DnaK OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=dnaK PE=3 SV=1 1 443 1.0E-141
sp|C1CQ18|DNAK_STRZT Chaperone protein DnaK OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dnaK PE=3 SV=1 1 436 1.0E-141
sp|C1CJ06|DNAK_STRZP Chaperone protein DnaK OS=Streptococcus pneumoniae (strain P1031) GN=dnaK PE=3 SV=1 1 436 1.0E-141
sp|Q8CWT3|DNAK_STRR6 Chaperone protein DnaK OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dnaK PE=3 SV=1 1 436 1.0E-141
sp|B1IA52|DNAK_STRPI Chaperone protein DnaK OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=dnaK PE=3 SV=1 1 436 1.0E-141
sp|C1C5N7|DNAK_STRP7 Chaperone protein DnaK OS=Streptococcus pneumoniae (strain 70585) GN=dnaK PE=3 SV=1 1 436 1.0E-141
sp|Q04LY0|DNAK_STRP2 Chaperone protein DnaK OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dnaK PE=3 SV=1 1 436 1.0E-141
sp|A0QLZ6|DNAK_MYCA1 Chaperone protein DnaK OS=Mycobacterium avium (strain 104) GN=dnaK PE=3 SV=1 1 451 2.0E-141
sp|P05646|DNAK_BACME Chaperone protein DnaK OS=Bacillus megaterium GN=dnaK PE=3 SV=3 1 443 2.0E-141
sp|B9M357|DNAK_GEODF Chaperone protein DnaK OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=dnaK PE=3 SV=1 1 436 2.0E-141
sp|A1WX31|DNAK_HALHL Chaperone protein DnaK OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dnaK PE=3 SV=1 1 457 2.0E-141
sp|P40150|HSP76_YEAST Heat shock protein SSB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSB2 PE=1 SV=2 1 385 2.0E-141
sp|Q45551|DNAK_GEOSE Chaperone protein DnaK OS=Geobacillus stearothermophilus GN=dnaK PE=3 SV=2 1 444 2.0E-141
sp|C1CCQ8|DNAK_STRZJ Chaperone protein DnaK OS=Streptococcus pneumoniae (strain JJA) GN=dnaK PE=3 SV=1 1 443 2.0E-141
sp|P95829|DNAK_STRPN Chaperone protein DnaK OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dnaK PE=3 SV=2 1 443 2.0E-141
sp|B8ZLY9|DNAK_STRPJ Chaperone protein DnaK OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dnaK PE=3 SV=1 1 443 2.0E-141
sp|Q707W3|HSP75_KLUDE Heat shock protein SSB OS=Kluyveromyces delphensis GN=SSB PE=3 SV=3 1 385 2.0E-141
sp|A1T2S3|DNAK_MYCVP Chaperone protein DnaK OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=dnaK PE=3 SV=1 1 439 2.0E-141
sp|C3L3G7|DNAK_CLOB6 Chaperone protein DnaK OS=Clostridium botulinum (strain 657 / Type Ba4) GN=dnaK PE=3 SV=1 1 451 2.0E-141
sp|Q03FR7|DNAK_PEDPA Chaperone protein DnaK OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=dnaK PE=3 SV=1 1 443 2.0E-141
sp|A4XKA4|DNAK_CALS8 Chaperone protein DnaK OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=dnaK PE=3 SV=1 1 444 3.0E-141
sp|B1I699|DNAK_DESAP Chaperone protein DnaK OS=Desulforudis audaxviator (strain MP104C) GN=dnaK PE=3 SV=1 1 443 3.0E-141
sp|Q9LCQ5|DNAK_BRECH Chaperone protein DnaK OS=Brevibacillus choshinensis GN=dnaK PE=3 SV=1 1 444 3.0E-141
sp|B5EC42|DNAK_GEOBB Chaperone protein DnaK OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=dnaK PE=3 SV=1 1 450 3.0E-141
sp|Q6HDK7|DNAK_BACHK Chaperone protein DnaK OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dnaK PE=3 SV=1 1 443 5.0E-141
sp|Q634M7|DNAK_BACCZ Chaperone protein DnaK OS=Bacillus cereus (strain ZK / E33L) GN=dnaK PE=3 SV=1 1 443 5.0E-141
sp|Q818E9|DNAK_BACCR Chaperone protein DnaK OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dnaK PE=3 SV=1 1 443 5.0E-141
sp|B7HCU0|DNAK_BACC4 Chaperone protein DnaK OS=Bacillus cereus (strain B4264) GN=dnaK PE=3 SV=1 1 443 5.0E-141
sp|C1ESK8|DNAK_BACC3 Chaperone protein DnaK OS=Bacillus cereus (strain 03BB102) GN=dnaK PE=3 SV=1 1 443 5.0E-141
sp|B7JN39|DNAK_BACC0 Chaperone protein DnaK OS=Bacillus cereus (strain AH820) GN=dnaK PE=3 SV=1 1 443 5.0E-141
sp|Q81LS2|DNAK_BACAN Chaperone protein DnaK OS=Bacillus anthracis GN=dnaK PE=3 SV=1 1 443 5.0E-141
sp|A0RIT3|DNAK_BACAH Chaperone protein DnaK OS=Bacillus thuringiensis (strain Al Hakam) GN=dnaK PE=3 SV=1 1 443 5.0E-141
sp|C3L5R7|DNAK_BACAC Chaperone protein DnaK OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dnaK PE=3 SV=1 1 443 5.0E-141
sp|C3P8M0|DNAK_BACAA Chaperone protein DnaK OS=Bacillus anthracis (strain A0248) GN=dnaK PE=3 SV=1 1 443 5.0E-141
sp|A9ILH7|DNAK_BART1 Chaperone protein DnaK OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=dnaK PE=3 SV=1 1 456 5.0E-141
sp|B7IYG7|DNAK_BACC2 Chaperone protein DnaK OS=Bacillus cereus (strain G9842) GN=dnaK PE=3 SV=1 1 443 5.0E-141
sp|Q93GF1|DNAK_PRELO Chaperone protein DnaK OS=Prevotella loescheii GN=dnaK PE=3 SV=1 1 448 6.0E-141
sp|A8YVQ3|DNAK_LACH4 Chaperone protein DnaK OS=Lactobacillus helveticus (strain DPC 4571) GN=dnaK PE=3 SV=1 1 443 7.0E-141
sp|Q8KML6|DNAK_LACSN Chaperone protein DnaK OS=Lactobacillus sanfranciscensis GN=dnaK PE=3 SV=1 1 461 7.0E-141
sp|Q3Z6P1|DNAK_DEHM1 Chaperone protein DnaK OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=dnaK PE=3 SV=1 1 463 7.0E-141
sp|A8AVA8|DNAK_STRGC Chaperone protein DnaK OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=dnaK PE=3 SV=1 1 436 7.0E-141
sp|Q1BEV1|DNAK_MYCSS Chaperone protein DnaK OS=Mycobacterium sp. (strain MCS) GN=dnaK PE=3 SV=1 1 439 8.0E-141
sp|A1UA31|DNAK_MYCSK Chaperone protein DnaK OS=Mycobacterium sp. (strain KMS) GN=dnaK PE=3 SV=1 1 439 8.0E-141
sp|A3PTN4|DNAK_MYCSJ Chaperone protein DnaK OS=Mycobacterium sp. (strain JLS) GN=dnaK PE=3 SV=1 1 439 8.0E-141
sp|Q04Y47|DNAK_LEPBL Chaperone protein DnaK OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=dnaK PE=3 SV=1 1 452 9.0E-141
sp|Q04VC8|DNAK_LEPBJ Chaperone protein DnaK OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=dnaK PE=3 SV=1 1 452 9.0E-141
sp|O69268|DNAK_LYSSH Chaperone protein DnaK OS=Lysinibacillus sphaericus GN=dnaK PE=3 SV=3 1 457 9.0E-141
sp|B8FGS3|DNAK_DESAA Chaperone protein DnaK OS=Desulfatibacillum alkenivorans (strain AK-01) GN=dnaK PE=3 SV=1 1 449 9.0E-141
sp|B1VMF3|DNAK_STRGG Chaperone protein DnaK OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=dnaK PE=3 SV=1 1 452 1.0E-140
sp|Q67S54|DNAK_SYMTH Chaperone protein DnaK OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=dnaK PE=3 SV=1 1 454 1.0E-140
sp|B9E6X1|DNAK_MACCJ Chaperone protein DnaK OS=Macrococcus caseolyticus (strain JCSC5402) GN=dnaK PE=3 SV=1 1 456 1.0E-140
sp|A5FPU4|DNAK_DEHMB Chaperone protein DnaK OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=dnaK PE=3 SV=1 1 463 1.0E-140
sp|Q65H54|DNAK_BACLD Chaperone protein DnaK OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dnaK PE=3 SV=1 1 444 1.0E-140
sp|Q8TQR2|DNAK_METAC Chaperone protein DnaK OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=dnaK PE=3 SV=1 1 443 1.0E-140
sp|B5E232|DNAK_STRP4 Chaperone protein DnaK OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=dnaK PE=3 SV=1 1 436 1.0E-140
sp|B8CXL1|DNAK_HALOH Chaperone protein DnaK OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=dnaK PE=3 SV=1 1 443 1.0E-140
sp|B3E7W9|DNAK_GEOLS Chaperone protein DnaK OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=dnaK PE=3 SV=1 1 457 2.0E-140
sp|Q74IT6|DNAK_LACJO Chaperone protein DnaK OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=dnaK PE=3 SV=1 1 443 2.0E-140
sp|C6E643|DNAK_GEOSM Chaperone protein DnaK OS=Geobacter sp. (strain M21) GN=dnaK PE=3 SV=1 1 451 2.0E-140
sp|Q3ZYV1|DNAK_DEHMC Chaperone protein DnaK OS=Dehalococcoides mccartyi (strain CBDB1) GN=dnaK PE=3 SV=1 1 463 2.0E-140
sp|B8FUN4|DNAK_DESHD Chaperone protein DnaK OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=dnaK PE=3 SV=1 1 448 2.0E-140
sp|Q6L0S7|DNAK_PICTO Chaperone protein DnaK OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=dnaK PE=3 SV=1 1 450 2.0E-140
sp|A1ANV0|DNAK_PELPD Chaperone protein DnaK OS=Pelobacter propionicus (strain DSM 2379) GN=dnaK PE=3 SV=1 1 458 2.0E-140
sp|P61443|DNAK_LEPIN Chaperone protein DnaK OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=dnaK PE=3 SV=1 1 452 2.0E-140
sp|Q00488|DNAK_MYCPA Chaperone protein DnaK OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=dnaK PE=3 SV=4 1 451 3.0E-140
sp|P45554|DNAK_STAAU Chaperone protein DnaK OS=Staphylococcus aureus GN=dnaK PE=3 SV=1 1 444 3.0E-140
sp|Q74H59|DNAK_GEOSL Chaperone protein DnaK OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=dnaK PE=3 SV=1 1 451 3.0E-140
sp|B1LZ51|DNAK_METRJ Chaperone protein DnaK OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=dnaK PE=3 SV=1 1 461 3.0E-140
sp|Q39PT7|DNAK_GEOMG Chaperone protein DnaK OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=dnaK PE=3 SV=1 1 458 3.0E-140
sp|Q1AXX6|DNAK_RUBXD Chaperone protein DnaK OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=dnaK PE=3 SV=1 1 443 3.0E-140
sp|Q6AC76|DNAK_LEIXX Chaperone protein DnaK OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=dnaK PE=3 SV=1 1 436 3.0E-140
sp|P64408|DNAK_STAAW Chaperone protein DnaK OS=Staphylococcus aureus (strain MW2) GN=dnaK PE=3 SV=1 1 444 3.0E-140
sp|A8Z4B9|DNAK_STAAT Chaperone protein DnaK OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dnaK PE=3 SV=1 1 444 3.0E-140
sp|Q6G8Y7|DNAK_STAAS Chaperone protein DnaK OS=Staphylococcus aureus (strain MSSA476) GN=dnaK PE=3 SV=1 1 444 3.0E-140
sp|Q6GGC0|DNAK_STAAR Chaperone protein DnaK OS=Staphylococcus aureus (strain MRSA252) GN=dnaK PE=3 SV=1 1 444 3.0E-140
sp|P99110|DNAK_STAAN Chaperone protein DnaK OS=Staphylococcus aureus (strain N315) GN=dnaK PE=1 SV=1 1 444 3.0E-140
sp|P64407|DNAK_STAAM Chaperone protein DnaK OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dnaK PE=3 SV=1 1 444 3.0E-140
sp|A6QHC3|DNAK_STAAE Chaperone protein DnaK OS=Staphylococcus aureus (strain Newman) GN=dnaK PE=3 SV=1 1 444 3.0E-140
sp|Q5HFI0|DNAK_STAAC Chaperone protein DnaK OS=Staphylococcus aureus (strain COL) GN=dnaK PE=3 SV=1 1 444 3.0E-140
sp|A5ITA8|DNAK_STAA9 Chaperone protein DnaK OS=Staphylococcus aureus (strain JH9) GN=dnaK PE=3 SV=1 1 444 3.0E-140
sp|Q2FXZ2|DNAK_STAA8 Chaperone protein DnaK OS=Staphylococcus aureus (strain NCTC 8325) GN=dnaK PE=3 SV=1 1 444 3.0E-140
sp|Q2FGE3|DNAK_STAA3 Chaperone protein DnaK OS=Staphylococcus aureus (strain USA300) GN=dnaK PE=3 SV=1 1 444 3.0E-140
sp|A6U252|DNAK_STAA2 Chaperone protein DnaK OS=Staphylococcus aureus (strain JH1) GN=dnaK PE=3 SV=1 1 444 3.0E-140
sp|A7X2Y1|DNAK_STAA1 Chaperone protein DnaK OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dnaK PE=3 SV=1 1 444 3.0E-140
sp|B0TAD7|DNAK_HELMI Chaperone protein DnaK OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=dnaK PE=3 SV=1 1 452 4.0E-140
sp|Q4JXX6|DNAK_CORJK Chaperone protein DnaK OS=Corynebacterium jeikeium (strain K411) GN=dnaK PE=3 SV=1 1 385 4.0E-140
sp|P61442|DNAK_LEPIC Chaperone protein DnaK OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=dnaK PE=3 SV=1 1 448 5.0E-140
sp|Q8FXX2|DNAK_BRUSU Chaperone protein DnaK OS=Brucella suis biovar 1 (strain 1330) GN=dnaK PE=3 SV=1 1 443 6.0E-140
sp|Q2YT47|DNAK_STAAB Chaperone protein DnaK OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dnaK PE=3 SV=1 1 444 7.0E-140
sp|P48721|GRP75_RAT Stress-70 protein, mitochondrial OS=Rattus norvegicus GN=Hspa9 PE=1 SV=3 1 444 7.0E-140
sp|B8IHL3|DNAK_METNO Chaperone protein DnaK OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=dnaK PE=3 SV=1 1 461 7.0E-140
sp|Q044A9|DNAK_LACGA Chaperone protein DnaK OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=dnaK PE=3 SV=1 1 443 7.0E-140
sp|Q5NPS6|DNAK_ZYMMO Chaperone protein DnaK OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=dnaK PE=3 SV=1 1 444 8.0E-140
sp|Q8FM78|DNAK_COREF Chaperone protein DnaK OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=dnaK PE=3 SV=1 1 413 9.0E-140
sp|Q75E44|HSP75_ASHGO Heat shock protein SSB OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SSB PE=3 SV=3 1 434 9.0E-140
sp|Q835R7|DNAK_ENTFA Chaperone protein DnaK OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=dnaK PE=3 SV=1 1 444 1.0E-139
sp|A4IR31|DNAK_GEOTN Chaperone protein DnaK OS=Geobacillus thermodenitrificans (strain NG80-2) GN=dnaK PE=3 SV=1 1 444 1.0E-139
sp|P69377|DNAK_PORUM Chaperone protein dnaK OS=Porphyra umbilicalis GN=dnaK PE=3 SV=1 1 438 1.0E-139
sp|P69376|DNAK_PORPU Chaperone protein dnaK OS=Porphyra purpurea GN=dnaK PE=3 SV=1 1 438 1.0E-139
sp|P11141|HSP7F_CAEEL Heat shock 70 kDa protein F, mitochondrial OS=Caenorhabditis elegans GN=hsp-6 PE=1 SV=2 1 458 1.0E-139
sp|P0DJM2|DNAK_LISMO Chaperone protein DnaK OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dnaK PE=3 SV=1 1 436 1.0E-139
sp|G2K046|DNAK_LISM4 Chaperone protein DnaK OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=dnaK PE=3 SV=1 1 436 1.0E-139
sp|B3PXH3|DNAK_RHIE6 Chaperone protein DnaK OS=Rhizobium etli (strain CIAT 652) GN=dnaK PE=3 SV=1 1 443 1.0E-139
sp|Q9TLT1|DNAK_CYACA Chaperone protein dnaK OS=Cyanidium caldarium GN=dnaK PE=3 SV=1 1 415 1.0E-139
sp|A9W6R7|DNAK_METEP Chaperone protein DnaK OS=Methylobacterium extorquens (strain PA1) GN=dnaK PE=3 SV=1 1 456 1.0E-139
sp|A3CQC2|DNAK_STRSV Chaperone protein DnaK OS=Streptococcus sanguinis (strain SK36) GN=dnaK PE=3 SV=1 1 443 1.0E-139
sp|Q8YE76|DNAK_BRUME Chaperone protein DnaK OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dnaK PE=3 SV=2 1 443 1.0E-139
sp|C0QGP6|DNAK_DESAH Chaperone protein DnaK OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=dnaK PE=3 SV=1 1 457 1.0E-139
sp|Q05981|DNAK_BRUO2 Chaperone protein DnaK OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dnaK PE=2 SV=2 1 443 2.0E-139
sp|Q57AD7|DNAK_BRUAB Chaperone protein DnaK OS=Brucella abortus biovar 1 (strain 9-941) GN=dnaK PE=3 SV=1 1 443 2.0E-139
sp|Q0RBC4|DNAK_FRAAA Chaperone protein DnaK OS=Frankia alni (strain ACN14a) GN=dnaK PE=3 SV=1 1 398 2.0E-139
sp|A6UEY0|DNAK_SINMW Chaperone protein DnaK OS=Sinorhizobium medicae (strain WSM419) GN=dnaK PE=3 SV=1 1 445 2.0E-139
sp|C0ZB48|DNAK_BREBN Chaperone protein DnaK OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=dnaK PE=3 SV=1 1 443 2.0E-139
sp|Q71ZJ7|DNAK_LISMF Chaperone protein DnaK OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dnaK PE=3 SV=3 1 443 2.0E-139
sp|C1KVC0|DNAK_LISMC Chaperone protein DnaK OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dnaK PE=3 SV=1 1 443 2.0E-139
sp|Q5ZM98|GRP75_CHICK Stress-70 protein, mitochondrial OS=Gallus gallus GN=HSPA9 PE=1 SV=1 1 370 2.0E-139
sp|B0RBI1|DNAK_CLAMS Chaperone protein DnaK OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=dnaK PE=3 SV=1 1 461 2.0E-139
sp|Q92BN8|DNAK_LISIN Chaperone protein DnaK OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dnaK PE=3 SV=3 1 379 2.0E-139
sp|A5CM86|DNAK_CLAM3 Chaperone protein DnaK OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=dnaK PE=3 SV=1 1 461 3.0E-139
sp|B7KSZ4|DNAK_METC4 Chaperone protein DnaK OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=dnaK PE=3 SV=1 1 456 3.0E-139
sp|Q2KDW6|DNAK_RHIEC Chaperone protein DnaK OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=dnaK PE=3 SV=1 1 443 3.0E-139
sp|B8I305|DNAK_CLOCE Chaperone protein DnaK OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=dnaK PE=3 SV=1 1 462 3.0E-139
sp|Q5P1H5|DNAK_AROAE Chaperone protein DnaK OS=Aromatoleum aromaticum (strain EbN1) GN=dnaK PE=3 SV=1 1 455 3.0E-139
sp|Q6NEY9|DNAK_CORDI Chaperone protein DnaK OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=dnaK PE=3 SV=1 1 436 3.0E-139
sp|P64409|DNAK_TROWT Chaperone protein DnaK OS=Tropheryma whipplei (strain Twist) GN=dnaK PE=3 SV=1 1 439 4.0E-139
sp|P64410|DNAK_TROW8 Chaperone protein DnaK OS=Tropheryma whipplei (strain TW08/27) GN=dnaK PE=3 SV=1 1 439 4.0E-139
sp|B0S1F8|DNAK_FINM2 Chaperone protein DnaK OS=Finegoldia magna (strain ATCC 29328) GN=dnaK PE=3 SV=1 1 455 5.0E-139
sp|B2HPS1|DNAK_MYCMM Chaperone protein DnaK OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=dnaK PE=3 SV=1 1 414 5.0E-139
sp|B9MJZ1|DNAK_CALBD Chaperone protein DnaK OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=dnaK PE=3 SV=1 1 444 6.0E-139
sp|B3Q972|DNAK_RHOPT Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain TIE-1) GN=dnaK PE=3 SV=1 1 444 7.0E-139
sp|Q6NCY4|DNAK_RHOPA Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=dnaK PE=3 SV=1 1 444 7.0E-139
sp|Q73Q16|DNAK_TREDE Chaperone protein DnaK OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=dnaK PE=3 SV=1 1 457 7.0E-139
sp|P42374|DNAK_RHIME Chaperone protein DnaK OS=Rhizobium meliloti (strain 1021) GN=dnaK PE=3 SV=2 1 445 7.0E-139
sp|O05700|DNAK_RHOS7 Chaperone protein DnaK OS=Rhodopseudomonas sp. (strain No.7) GN=dnaK PE=3 SV=1 1 444 8.0E-139
sp|C3PJM6|DNAK_CORA7 Chaperone protein DnaK OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=dnaK PE=3 SV=1 1 380 8.0E-139
sp|P83784|HSP77_CANAL Heat shock protein SSC1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSC1 PE=1 SV=2 1 456 8.0E-139
sp|Q182E8|DNAK_PEPD6 Chaperone protein DnaK OS=Peptoclostridium difficile (strain 630) GN=dnaK PE=3 SV=1 1 444 9.0E-139
sp|B8DT62|DNAK_BIFA0 Chaperone protein DnaK OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=dnaK PE=3 SV=1 1 443 1.0E-138
sp|B3R6G7|DNAK_CUPTR Chaperone protein DnaK OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=dnaK PE=3 SV=1 1 436 1.0E-138
sp|A4QHJ0|DNAK_CORGB Chaperone protein DnaK OS=Corynebacterium glutamicum (strain R) GN=dnaK PE=3 SV=1 1 436 1.0E-138
sp|Q05558|DNAK_STRCO Chaperone protein DnaK OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=dnaK PE=3 SV=1 1 443 1.0E-138
sp|Q8NLY6|DNAK_CORGL Chaperone protein DnaK OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=dnaK PE=3 SV=1 1 436 1.0E-138
sp|Q6MNF8|DNAK_BDEBA Chaperone protein DnaK OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=dnaK PE=3 SV=1 1 458 2.0E-138
sp|Q11KJ6|DNAK_CHESB Chaperone protein DnaK OS=Chelativorans sp. (strain BNC1) GN=dnaK PE=3 SV=1 1 461 2.0E-138
sp|C4L425|DNAK_EXISA Chaperone protein DnaK OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=dnaK PE=3 SV=1 1 463 2.0E-138
sp|Q03QU1|DNAK_LACBA Chaperone protein DnaK OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=dnaK PE=3 SV=1 1 449 2.0E-138
sp|Q1MN11|DNAK_RHIL3 Chaperone protein DnaK OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=dnaK PE=3 SV=1 1 458 2.0E-138
sp|B1VHX4|DNAK_CORU7 Chaperone protein DnaK OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=dnaK PE=3 SV=1 1 444 3.0E-138
sp|B3QMB2|DNAK_CHLP8 Chaperone protein DnaK OS=Chlorobaculum parvum (strain NCIB 8327) GN=dnaK PE=3 SV=1 1 462 4.0E-138
sp|Q10284|HSP75_SCHPO Heat shock protein sks2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sks2 PE=1 SV=2 1 401 4.0E-138
sp|A0B747|DNAK_METTP Chaperone protein DnaK OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=dnaK PE=3 SV=1 1 447 4.0E-138
sp|B1HUD1|DNAK_LYSSC Chaperone protein DnaK OS=Lysinibacillus sphaericus (strain C3-41) GN=dnaK PE=3 SV=1 1 443 4.0E-138
sp|Q1GKS3|DNAK_RUEST Chaperone protein DnaK OS=Ruegeria sp. (strain TM1040) GN=dnaK PE=3 SV=1 1 454 4.0E-138
sp|P11503|HSP70_ONCVO Heat shock 70 kDa protein (Fragment) OS=Onchocerca volvulus PE=2 SV=2 78 387 5.0E-138
sp|A4WW89|DNAK_RHOS5 Chaperone protein DnaK OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=dnaK PE=3 SV=1 1 457 5.0E-138
sp|B7ID00|DNAK_THEAB Chaperone protein DnaK OS=Thermosipho africanus (strain TCF52B) GN=dnaK PE=3 SV=1 1 436 5.0E-138
sp|B8DE38|DNAK_LISMH Chaperone protein DnaK OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dnaK PE=3 SV=1 1 443 5.0E-138
sp|A1UUC3|DNAK_BARBK Chaperone protein DnaK OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=dnaK PE=3 SV=1 1 452 5.0E-138
sp|Q8YW74|DNAK2_NOSS1 Chaperone protein dnaK2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=dnaK2 PE=3 SV=1 1 443 5.0E-138
sp|P19993|DNAK_MYCLE Chaperone protein DnaK OS=Mycobacterium leprae (strain TN) GN=dnaK PE=1 SV=5 1 452 6.0E-138
sp|B8ZTB7|DNAK_MYCLB Chaperone protein DnaK OS=Mycobacterium leprae (strain Br4923) GN=dnaK PE=3 SV=1 1 452 6.0E-138
sp|P87222|HSP75_CANAW Heat shock protein SSB1 OS=Candida albicans (strain WO-1) GN=SSB1 PE=3 SV=2 1 418 6.0E-138
sp|Q5FFM4|DNAK_EHRRG Chaperone protein DnaK OS=Ehrlichia ruminantium (strain Gardel) GN=dnaK PE=3 SV=1 1 434 8.0E-138
sp|B1ZGR1|DNAK_METPB Chaperone protein DnaK OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=dnaK PE=3 SV=1 1 436 8.0E-138
sp|Q5HAY1|DNAK_EHRRW Chaperone protein DnaK OS=Ehrlichia ruminantium (strain Welgevonden) GN=dnaK PE=3 SV=1 1 434 8.0E-138
sp|B2G6W3|DNAK_LACRJ Chaperone protein DnaK OS=Lactobacillus reuteri (strain JCM 1112) GN=dnaK PE=3 SV=1 1 443 1.0E-137
sp|A5VJE7|DNAK_LACRD Chaperone protein DnaK OS=Lactobacillus reuteri (strain DSM 20016) GN=dnaK PE=3 SV=1 1 443 1.0E-137
sp|Q3IYM7|DNAK_RHOS4 Chaperone protein DnaK OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=dnaK PE=3 SV=1 1 457 1.0E-137
sp|A3PNM1|DNAK_RHOS1 Chaperone protein DnaK OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=dnaK PE=3 SV=1 1 457 1.0E-137
sp|Q06W39|DNAK_PYRHA Chaperone protein dnaK OS=Pyropia haitanensis GN=dnaK PE=3 SV=1 1 387 1.0E-137
sp|Q98DD1|DNAK_RHILO Chaperone protein DnaK OS=Rhizobium loti (strain MAFF303099) GN=dnaK PE=3 SV=1 1 436 1.0E-137
sp|Q1MPW1|DNAK_LAWIP Chaperone protein DnaK OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=dnaK PE=3 SV=1 1 458 2.0E-137
sp|B2GBQ5|DNAK_LACF3 Chaperone protein DnaK OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=dnaK PE=3 SV=1 1 443 2.0E-137
sp|P9WMJ9|DNAK_MYCTU Chaperone protein DnaK OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dnaK PE=1 SV=1 1 386 2.0E-137
sp|P9WMJ8|DNAK_MYCTO Chaperone protein DnaK OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dnaK PE=3 SV=1 1 386 2.0E-137
sp|A5TZ77|DNAK_MYCTA Chaperone protein DnaK OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=dnaK PE=3 SV=1 1 386 2.0E-137
sp|C1AK26|DNAK_MYCBT Chaperone protein DnaK OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=dnaK PE=3 SV=1 1 386 2.0E-137
sp|A1KFH2|DNAK_MYCBP Chaperone protein DnaK OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=dnaK PE=3 SV=1 1 386 2.0E-137
sp|P0A5C0|DNAK_MYCBO Chaperone protein DnaK OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=dnaK PE=3 SV=2 1 386 2.0E-137
sp|Q46XI7|DNAK_CUPPJ Chaperone protein DnaK OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=dnaK PE=3 SV=1 1 436 2.0E-137
sp|A5FGL1|DNAK_FLAJ1 Chaperone protein DnaK OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=dnaK PE=3 SV=1 1 456 2.0E-137
sp|P0C937|DNAK_PORGI Chaperone protein DnaK OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=dnaK PE=3 SV=1 1 459 2.0E-137
sp|Q6MT06|DNAK_MYCMS Chaperone protein DnaK OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=dnaK PE=3 SV=1 1 407 2.0E-137
sp|Q5LWJ6|DNAK_RUEPO Chaperone protein DnaK OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dnaK PE=3 SV=1 1 449 2.0E-137
sp|A6LDG8|DNAK_PARD8 Chaperone protein DnaK OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=dnaK PE=3 SV=1 1 436 2.0E-137
sp|A1BET8|DNAK_CHLPD Chaperone protein DnaK OS=Chlorobium phaeobacteroides (strain DSM 266) GN=dnaK PE=3 SV=1 1 454 2.0E-137
sp|Q82EX9|DNAK1_STRAW Chaperone protein dnaK1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=dnaK1 PE=3 SV=1 1 443 3.0E-137
sp|B2RJ90|DNAK_PORG3 Chaperone protein DnaK OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=dnaK PE=3 SV=1 1 413 3.0E-137
sp|A6GXZ1|DNAK_FLAPJ Chaperone protein DnaK OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=dnaK PE=3 SV=1 1 407 4.0E-137
sp|P50019|DNAK_AGRFC Chaperone protein DnaK OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dnaK PE=2 SV=2 1 457 4.0E-137
sp|A6WFV7|DNAK_KINRD Chaperone protein DnaK OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=dnaK PE=3 SV=1 1 385 5.0E-137
sp|B1YKS9|DNAK_EXIS2 Chaperone protein DnaK OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=dnaK PE=3 SV=1 1 444 5.0E-137
sp|A0PLQ1|DNAK_MYCUA Chaperone protein DnaK OS=Mycobacterium ulcerans (strain Agy99) GN=dnaK PE=3 SV=1 1 412 5.0E-137
sp|Q661A3|DNAK_BORBP Chaperone protein DnaK OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=dnaK PE=3 SV=1 1 456 6.0E-137
sp|B0UR84|DNAK_METS4 Chaperone protein DnaK OS=Methylobacterium sp. (strain 4-46) GN=dnaK PE=3 SV=1 1 436 7.0E-137
sp|O85282|DNAK_NEOSE Chaperone protein DnaK OS=Neorickettsia sennetsu GN=dnaK PE=3 SV=1 1 444 7.0E-137
sp|Q12WE6|DNAK_METBU Chaperone protein DnaK OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=dnaK PE=3 SV=1 1 455 7.0E-137
sp|Q1XDH2|DNAK_PYRYE Chaperone protein dnaK OS=Pyropia yezoensis GN=dnaK PE=3 SV=1 1 387 7.0E-137
sp|B2IBR4|DNAK_BEII9 Chaperone protein DnaK OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=dnaK PE=3 SV=1 1 455 8.0E-137
sp|Q5M6D1|DNAK_STRT2 Chaperone protein DnaK OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=dnaK PE=3 SV=1 1 436 8.0E-137
sp|Q03MR6|DNAK_STRTD Chaperone protein DnaK OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=dnaK PE=3 SV=1 1 436 8.0E-137
sp|Q5M1T8|DNAK_STRT1 Chaperone protein DnaK OS=Streptococcus thermophilus (strain CNRZ 1066) GN=dnaK PE=3 SV=1 1 436 8.0E-137
sp|B8EIP9|DNAK_METSB Chaperone protein DnaK OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=dnaK PE=3 SV=1 1 461 9.0E-137
sp|C0ZT86|DNAK_RHOE4 Chaperone protein DnaK OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=dnaK PE=3 SV=1 1 375 9.0E-137
sp|A8Z5V5|DNAK_SULMW Chaperone protein DnaK OS=Sulcia muelleri (strain GWSS) GN=dnaK PE=3 SV=1 1 408 1.0E-136
sp|Q7VVY2|DNAK_BORPE Chaperone protein DnaK OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=dnaK PE=3 SV=1 1 436 1.0E-136
sp|Q2GF34|DNAK_NEOSM Chaperone protein DnaK OS=Neorickettsia sennetsu (strain Miyayama) GN=dnaK PE=3 SV=1 1 444 1.0E-136
sp|Q54215|DNAK_STRGR Chaperone protein DnaK OS=Streptomyces griseus GN=dnaK PE=3 SV=1 1 412 1.0E-136
sp|A0K1L3|DNAK_ARTS2 Chaperone protein DnaK OS=Arthrobacter sp. (strain FB24) GN=dnaK PE=3 SV=1 1 462 1.0E-136
sp|Q7WGI4|DNAK_BORBR Chaperone protein DnaK OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=dnaK PE=3 SV=1 1 436 1.0E-136
sp|Q2SSB0|DNAK_MYCCT Chaperone protein DnaK OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=dnaK PE=3 SV=1 1 407 1.0E-136
sp|A8ZRW3|DNAK_DESOH Chaperone protein DnaK OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=dnaK PE=3 SV=1 1 457 1.0E-136
sp|Q7W519|DNAK_BORPA Chaperone protein DnaK OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=dnaK PE=3 SV=1 1 436 1.0E-136
sp|Q0K757|DNAK_CUPNH Chaperone protein DnaK OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=dnaK PE=3 SV=1 1 436 1.0E-136
sp|Q02028|HSP7S_PEA Stromal 70 kDa heat shock-related protein, chloroplastic OS=Pisum sativum GN=HSP70 PE=2 SV=1 1 408 2.0E-136
sp|Q0SMZ0|DNAK_BORAP Chaperone protein DnaK OS=Borrelia afzelii (strain PKo) GN=dnaK PE=3 SV=1 1 456 2.0E-136
sp|Q7V3T5|DNAK2_PROMM Chaperone protein dnaK2 OS=Prochlorococcus marinus (strain MIT 9313) GN=dnaK2 PE=3 SV=1 1 444 2.0E-136
sp|Q7UZG3|DNAK2_PROMP Chaperone protein dnaK2 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=dnaK2 PE=3 SV=1 1 452 2.0E-136
sp|Q8KEP3|DNAK_CHLTE Chaperone protein DnaK OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=dnaK PE=3 SV=1 1 460 2.0E-136
sp|B5ZWQ2|DNAK_RHILW Chaperone protein DnaK OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=dnaK PE=3 SV=1 1 443 3.0E-136
sp|P29215|DNAK_GUITH Chaperone protein dnaK OS=Guillardia theta GN=dnaK PE=3 SV=2 1 407 3.0E-136
sp|B3EHR1|DNAK_CHLL2 Chaperone protein DnaK OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=dnaK PE=3 SV=1 1 457 3.0E-136
sp|Q3SW76|DNAK_NITWN Chaperone protein DnaK OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=dnaK PE=3 SV=1 1 444 3.0E-136
sp|Q9STW6|HSP7F_ARATH Heat shock 70 kDa protein 6, chloroplastic OS=Arabidopsis thaliana GN=HSP70-6 PE=1 SV=1 1 399 4.0E-136
sp|O33528|DNAK_RHILE Chaperone protein DnaK OS=Rhizobium leguminosarum GN=dnaK PE=3 SV=1 1 452 4.0E-136
sp|Q3APD2|DNAK_CHLCH Chaperone protein DnaK OS=Chlorobium chlorochromatii (strain CaD3) GN=dnaK PE=3 SV=1 1 455 4.0E-136
sp|Q6B8V2|DNAK_GRATL Chaperone protein dnaK OS=Gracilaria tenuistipitata var. liui GN=dnaK PE=3 SV=1 1 444 4.0E-136
sp|B3DZP7|DNAK_METI4 Chaperone protein DnaK OS=Methylacidiphilum infernorum (isolate V4) GN=dnaK PE=3 SV=1 1 444 4.0E-136
sp|Q7NXI3|DNAK_CHRVO Chaperone protein DnaK OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=dnaK PE=3 SV=1 1 436 4.0E-136
sp|Q08080|HSP7S_SPIOL Stromal 70 kDa heat shock-related protein, chloroplastic (Fragment) OS=Spinacia oleracea GN=CHSP70 PE=2 SV=1 1 455 5.0E-136
sp|Q2J320|DNAK_RHOP2 Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain HaA2) GN=dnaK PE=3 SV=1 1 458 5.0E-136
sp|Q8G6W1|DNAK_BIFLO Chaperone protein DnaK OS=Bifidobacterium longum (strain NCC 2705) GN=dnaK PE=3 SV=1 1 436 5.0E-136
sp|B3DNP9|DNAK_BIFLD Chaperone protein DnaK OS=Bifidobacterium longum (strain DJO10A) GN=dnaK PE=3 SV=1 1 436 5.0E-136
sp|B2UBP3|DNAK_RALPJ Chaperone protein DnaK OS=Ralstonia pickettii (strain 12J) GN=dnaK PE=3 SV=1 1 436 6.0E-136
sp|Q28VY3|DNAK_JANSC Chaperone protein DnaK OS=Jannaschia sp. (strain CCS1) GN=dnaK PE=3 SV=1 1 436 6.0E-136
sp|Q9LTX9|HSP7G_ARATH Heat shock 70 kDa protein 7, chloroplastic OS=Arabidopsis thaliana GN=HSP70-7 PE=2 SV=1 1 443 7.0E-136
sp|B6JCI3|DNAK_OLICO Chaperone protein DnaK OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=dnaK PE=3 SV=1 1 444 7.0E-136
sp|A6LM32|DNAK_THEM4 Chaperone protein DnaK OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=dnaK PE=3 SV=1 1 436 7.0E-136
sp|A0L4Z2|DNAK_MAGMM Chaperone protein DnaK OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=dnaK PE=3 SV=1 1 378 8.0E-136
sp|B7GT47|DNAK_BIFLS Chaperone protein DnaK OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=dnaK PE=3 SV=1 1 436 9.0E-136
sp|P0CY99|DNAK_PROAC Chaperone protein DnaK OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=dnaK PE=3 SV=1 1 431 1.0E-135
sp|P0CY98|DNAK_PROAA Chaperone protein DnaK OS=Propionibacterium acnes GN=dnaK PE=3 SV=1 1 431 1.0E-135
sp|Q1QRU1|DNAK_NITHX Chaperone protein DnaK OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=dnaK PE=3 SV=1 1 444 1.0E-135
sp|C1F2D2|DNAK_ACIC5 Chaperone protein DnaK OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=dnaK PE=3 SV=1 1 445 1.0E-135
sp|Q2KWA2|DNAK_BORA1 Chaperone protein DnaK OS=Bordetella avium (strain 197N) GN=dnaK PE=3 SV=1 1 436 1.0E-135
sp|A8IPT1|DNAK_AZOC5 Chaperone protein DnaK OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=dnaK PE=3 SV=1 1 456 1.0E-135
sp|A7IC65|DNAK_XANP2 Chaperone protein DnaK OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=dnaK PE=3 SV=1 1 453 1.0E-135
sp|Q13E60|DNAK_RHOPS Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain BisB5) GN=dnaK PE=3 SV=1 1 458 1.0E-135
sp|Q7V9G2|DNAK2_PROMA Chaperone protein dnaK2 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=dnaK2 PE=3 SV=1 1 463 1.0E-135
sp|B2GGP0|DNAK_KOCRD Chaperone protein DnaK OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=dnaK PE=3 SV=1 1 436 1.0E-135
[Show less]

GO

GO Term Description Terminal node
GO:0000902 cell morphogenesis Yes
GO:0009987 cellular process No
GO:0071840 cellular component organization or biogenesis No
GO:0008150 biological_process No
GO:0048869 cellular developmental process No
GO:0009653 anatomical structure morphogenesis No
GO:0016043 cellular component organization No
GO:0032989 cellular component morphogenesis No
GO:0032502 developmental process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4859
LNVLRIVNEPTAAAIAYGLDKTDKERQIIVYDLGGGTFDVSLLSIEQGVFEVLATAGDTHLGGEDFDQRLIEHFV
KLHKKRHTVDVSKDLKAMSKLKREAEKAKRTLSSQMNTRIEIEAFYQGQDFSETLTRAKFEELNIDLFRKTIKPV
EQVLKDAKVSKEDINDIVLVGGSTRIPKVQHLIEQYFGKKASKGINPDEAVAYGAAVQAGVLSGEEGTEDIVLMD
VNPLTLGIETTGGVMTKLIPRNTPIPTRKSQIFSTAADNQPVVLIQVFEGERSMTKDNNLLGKFELTGIPPAPRG
VPQIEVSFELDANGILKVSAHDKGTGKQESITITNDKGRLTQDEIDRMVAEAEKYAEEDKATRERIEARNGLENY
AFNLKNQVNDEEGLGGKIDAEEKETLLDAIKEATEWLDENGADATAEDFNEQKEKLSNVAYPITSKMYQGAGGEG
AAKEEEGDFHDEL*
Coding >Hirsu2|4859
CTGAACGTTCTTCGGATCGTTAACGAGCCCACTGCCGCCGCCATTGCCTATGGTCTGGACAAGACGGACAAGGAG
CGCCAGATCATCGTCTACGATCTTGGCGGCGGCACCTTCGACGTGTCCCTTCTCTCGATCGAGCAGGGTGTGTTC
GAGGTGCTGGCCACCGCTGGTGACACTCACCTGGGCGGCGAGGACTTCGACCAGCGCCTCATCGAGCACTTCGTC
AAGCTGCACAAGAAGAGACACACCGTCGATGTCAGCAAGGACCTCAAGGCCATGAGCAAGCTGAAGCGGGAGGCC
GAGAAGGCCAAGCGCACCCTCTCGTCGCAGATGAACACCCGCATCGAAATCGAGGCTTTCTACCAGGGCCAGGAC
TTCTCTGAGACCCTAACCCGCGCCAAGTTCGAGGAGCTTAACATCGATCTCTTCAGGAAGACGATTAAGCCCGTC
GAGCAGGTTCTCAAGGACGCCAAGGTTAGCAAGGAGGACATCAACGACATCGTCCTTGTCGGTGGCTCGACCCGT
ATCCCCAAGGTCCAGCACTTGATCGAGCAGTACTTTGGCAAGAAAGCCTCCAAGGGCATCAACCCCGACGAGGCT
GTTGCCTACGGTGCCGCCGTCCAGGCTGGTGTTCTTTCCGGCGAGGAGGGCACTGAGGACATTGTCCTTATGGAC
GTCAACCCCCTGACGCTCGGTATCGAGACCACGGGCGGAGTCATGACCAAGTTGATTCCTCGCAACACTCCTATC
CCTACCCGCAAGAGCCAGATCTTCAGTACCGCCGCCGACAACCAGCCCGTCGTCCTGATCCAGGTGTTCGAGGGC
GAGCGTTCGATGACCAAGGACAACAACCTGTTGGGCAAGTTCGAGCTGACGGGCATTCCGCCGGCCCCGCGTGGC
GTTCCCCAGATCGAGGTGTCTTTCGAGCTGGACGCCAATGGTATCCTCAAGGTGTCGGCTCATGACAAGGGCACC
GGCAAGCAGGAGTCGATCACGATCACCAACGACAAGGGCCGTCTCACGCAGGATGAGATCGATCGCATGGTTGCC
GAGGCGGAGAAGTACGCCGAGGAGGACAAGGCTACGCGCGAGCGTATCGAGGCTCGCAACGGTCTGGAGAACTAT
GCCTTCAACCTCAAGAACCAGGTCAACGACGAGGAGGGTCTCGGTGGCAAGATTGACGCCGAGGAGAAGGAGACG
CTCCTGGACGCCATCAAGGAGGCCACCGAGTGGCTCGACGAGAACGGCGCCGACGCCACGGCCGAGGACTTCAAC
GAGCAGAAGGAGAAGCTGTCCAACGTGGCCTACCCCATCACCTCCAAGATGTACCAGGGAGCTGGTGGCGAGGGT
GCCGCCAAGGAGGAGGAGGGTGACTTCCATGATGAACTGTAA
Transcript >Hirsu2|4859
CTGAACGTTCTTCGGATCGTTAACGAGCCCACTGCCGCCGCCATTGCCTATGGTCTGGACAAGACGGACAAGGAG
CGCCAGATCATCGTCTACGATCTTGGCGGCGGCACCTTCGACGTGTCCCTTCTCTCGATCGAGCAGGGTGTGTTC
GAGGTGCTGGCCACCGCTGGTGACACTCACCTGGGCGGCGAGGACTTCGACCAGCGCCTCATCGAGCACTTCGTC
AAGCTGCACAAGAAGAGACACACCGTCGATGTCAGCAAGGACCTCAAGGCCATGAGCAAGCTGAAGCGGGAGGCC
GAGAAGGCCAAGCGCACCCTCTCGTCGCAGATGAACACCCGCATCGAAATCGAGGCTTTCTACCAGGGCCAGGAC
TTCTCTGAGACCCTAACCCGCGCCAAGTTCGAGGAGCTTAACATCGATCTCTTCAGGAAGACGATTAAGCCCGTC
GAGCAGGTTCTCAAGGACGCCAAGGTTAGCAAGGAGGACATCAACGACATCGTCCTTGTCGGTGGCTCGACCCGT
ATCCCCAAGGTCCAGCACTTGATCGAGCAGTACTTTGGCAAGAAAGCCTCCAAGGGCATCAACCCCGACGAGGCT
GTTGCCTACGGTGCCGCCGTCCAGGCTGGTGTTCTTTCCGGCGAGGAGGGCACTGAGGACATTGTCCTTATGGAC
GTCAACCCCCTGACGCTCGGTATCGAGACCACGGGCGGAGTCATGACCAAGTTGATTCCTCGCAACACTCCTATC
CCTACCCGCAAGAGCCAGATCTTCAGTACCGCCGCCGACAACCAGCCCGTCGTCCTGATCCAGGTGTTCGAGGGC
GAGCGTTCGATGACCAAGGACAACAACCTGTTGGGCAAGTTCGAGCTGACGGGCATTCCGCCGGCCCCGCGTGGC
GTTCCCCAGATCGAGGTGTCTTTCGAGCTGGACGCCAATGGTATCCTCAAGGTGTCGGCTCATGACAAGGGCACC
GGCAAGCAGGAGTCGATCACGATCACCAACGACAAGGGCCGTCTCACGCAGGATGAGATCGATCGCATGGTTGCC
GAGGCGGAGAAGTACGCCGAGGAGGACAAGGCTACGCGCGAGCGTATCGAGGCTCGCAACGGTCTGGAGAACTAT
GCCTTCAACCTCAAGAACCAGGTCAACGACGAGGAGGGTCTCGGTGGCAAGATTGACGCCGAGGAGAAGGAGACG
CTCCTGGACGCCATCAAGGAGGCCACCGAGTGGCTCGACGAGAACGGCGCCGACGCCACGGCCGAGGACTTCAAC
GAGCAGAAGGAGAAGCTGTCCAACGTGGCCTACCCCATCACCTCCAAGATGTACCAGGGAGCTGGTGGCGAGGGT
GCCGCCAAGGAGGAGGAGGGTGACTTCCATGATGAACTGTAA
Gene >Hirsu2|4859
CTGAACGTTCTTCGGATCGTTAACGAGCCCACTGCCGCCGCCATTGCCTATGGTCTGGACAAGACGGACAAGGAG
CGCCAGATCATCGTCTACGATCTTGGCGGCGGCACCTTCGACGTGTCCCTTCTCTCGATCGAGCAGGGTGTGTTC
GAGGTGCTGGCCACCGCTGGTGACACTCACCTGGGCGGCGAGGACTTCGACCAGCGCCTCATCGAGCACTTCGTC
AAGCTGCACAAGAAGAGACACACCGTCGATGTCAGCAAGGACCTCAAGGCCATGAGCAAGCTGAAGCGGGAGGCC
GAGAAGGCCAAGCGCACCCTCTCGTCGCAGATGAACACCCGCATCGAAATCGAGGCTTTCTACCAGGGCCAGGAC
TTCTCTGAGACCCTAACCCGCGCCAAGTTCGAGGAGCTTAACATCGATCTCTTCAGGAAGACGATTAAGCCCGTC
GAGCAGGTTCTCAAGGACGCCAAGGTTAGCAAGGAGGACATCAACGACATCGTCCTTGTCGGTGGCTCGACCCGT
ATCCCCAAGGTCCAGCACTTGATCGAGCAGTACTTTGGCAAGAAAGCCTCCAAGGGCATCAACCCCGACGAGGCT
GTTGCCTACGGTGCCGCCGTCCAGGCTGGTGTTCTTTCCGGCGAGGAGGGCACTGAGGACATTGTCCTTATGGAC
GTCAACCCCCTGACGCTCGGTATCGAGACCACGGGCGGAGTCATGACCAAGTTGATTCCTCGCAACACTCCTATC
CCTACCCGCAAGAGCCAGATCTTCAGTACCGCCGCCGACAACCAGCCCGTCGTCCTGATCCAGGTGTTCGAGGGC
GAGCGTTCGATGACCAAGGACAACAACCTGTTGGGCAAGTTCGAGCTGACGGGCATTCCGCCGGCCCCGCGTGGC
GTTCCCCAGATCGAGGTGTCTTTCGAGCTGGACGCCAATGGTATCCTCAAGGTGTCGGCTCATGACAAGGGCACC
GGCAAGCAGGAGTCGATCACGATCACCAACGACAAGGGCCGTCTCACGCAGGATGAGATCGATCGCATGGTTGCC
GAGGCGGAGAAGTACGCCGAGGAGGACAAGGCTACGCGCGAGCGTATCGAGGCTCGCAACGGTCTGGAGAACTAT
GCCTTCAACCTCAAGAACCAGGTCAACGACGAGGAGGGTCTCGGTGGCAAGATTGACGCCGAGGAGAAGGAGACG
GTAAGTTACACACATGCGCTGCCTGCCGAGACCACGGCACGTGCTGACCAATCGACTAGCTCCTGGACGCCATCA
AGGAGGCCACCGAGTGGCTCGACGAGAACGGCGCCGACGCCACGGCCGAGGACTTCAACGAGCAGAAGGAGAAGC
TGTCCAACGTGGCCTACCCCATCACCTCCAAGATGTACCAGGGAGCTGGTGGCGAGGGTGCCGCCAAGGAGGAGG
AGGGTGACTTCCATGATGAACTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail