Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4855
Gene name
LocationContig_2443:96..2238
Strand-
Gene length (bp)2142
Transcript length (bp)2001
Coding sequence length (bp)2001
Protein length (aa) 667

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04433 SWIRM SWIRM domain 7.8E-32 91 176
PF16495 SWIRM-assoc_1 SWIRM-associated region 1 2.2E-30 533 614
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 1.8E-10 353 395
PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain 3.3E-06 354 396

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14470|SSR2_SCHPO SWI/SNF and RSC complexes subunit ssr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssr2 PE=1 SV=3 81 629 9.0E-93
sp|O13788|SSR1_SCHPO SWI/SNF and RSC complexes subunit ssr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssr1 PE=1 SV=1 58 614 2.0E-80
sp|P43609|RSC8_YEAST Chromatin structure-remodeling complex protein RSC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSC8 PE=1 SV=1 51 437 3.0E-80
sp|P32591|SWI3_YEAST SWI/SNF complex subunit SWI3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWI3 PE=1 SV=1 82 610 8.0E-75
sp|Q8TAQ2|SMRC2_HUMAN SWI/SNF complex subunit SMARCC2 OS=Homo sapiens GN=SMARCC2 PE=1 SV=1 57 210 2.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14470|SSR2_SCHPO SWI/SNF and RSC complexes subunit ssr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssr2 PE=1 SV=3 81 629 9.0E-93
sp|O13788|SSR1_SCHPO SWI/SNF and RSC complexes subunit ssr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssr1 PE=1 SV=1 58 614 2.0E-80
sp|P43609|RSC8_YEAST Chromatin structure-remodeling complex protein RSC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSC8 PE=1 SV=1 51 437 3.0E-80
sp|P32591|SWI3_YEAST SWI/SNF complex subunit SWI3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWI3 PE=1 SV=1 82 610 8.0E-75
sp|Q8TAQ2|SMRC2_HUMAN SWI/SNF complex subunit SMARCC2 OS=Homo sapiens GN=SMARCC2 PE=1 SV=1 57 210 2.0E-58
sp|Q6PDG5|SMRC2_MOUSE SWI/SNF complex subunit SMARCC2 OS=Mus musculus GN=Smarcc2 PE=1 SV=2 57 210 2.0E-58
sp|Q9XI07|SWI3C_ARATH SWI/SNF complex subunit SWI3C OS=Arabidopsis thaliana GN=SWI3C PE=1 SV=1 89 600 3.0E-58
sp|Q92922|SMRC1_HUMAN SWI/SNF complex subunit SMARCC1 OS=Homo sapiens GN=SMARCC1 PE=1 SV=3 80 205 5.0E-53
sp|P97496|SMRC1_MOUSE SWI/SNF complex subunit SMARCC1 OS=Mus musculus GN=Smarcc1 PE=1 SV=2 80 205 6.0E-53
sp|Q84JG2|SWI3B_ARATH SWI/SNF complex subunit SWI3B OS=Arabidopsis thaliana GN=SWI3B PE=1 SV=1 83 614 8.0E-34
sp|Q8W475|SWI3A_ARATH SWI/SNF complex subunit SWI3A OS=Arabidopsis thaliana GN=SWI3A PE=1 SV=1 90 404 5.0E-29
sp|Q8VY05|SWI3D_ARATH SWI/SNF complex subunit SWI3D OS=Arabidopsis thaliana GN=SWI3D PE=1 SV=3 89 402 2.0E-25
sp|Q54J55|MYBX_DICDI Myb-like protein X OS=Dictyostelium discoideum GN=mybX PE=3 SV=1 290 460 4.0E-18
sp|Q8TAQ2|SMRC2_HUMAN SWI/SNF complex subunit SMARCC2 OS=Homo sapiens GN=SMARCC2 PE=1 SV=1 369 454 9.0E-14
sp|Q6PDG5|SMRC2_MOUSE SWI/SNF complex subunit SMARCC2 OS=Mus musculus GN=Smarcc2 PE=1 SV=2 369 454 1.0E-13
sp|Q92922|SMRC1_HUMAN SWI/SNF complex subunit SMARCC1 OS=Homo sapiens GN=SMARCC1 PE=1 SV=3 369 446 1.0E-12
sp|P97496|SMRC1_MOUSE SWI/SNF complex subunit SMARCC1 OS=Mus musculus GN=Smarcc1 PE=1 SV=2 369 446 1.0E-12
sp|Q5RGA4|MYSM1_DANRE Histone H2A deubiquitinase MYSM1 OS=Danio rerio GN=mysm1 PE=2 SV=2 91 179 4.0E-10
sp|Q9P7J7|ADA2_SCHPO Transcriptional adapter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ada2 PE=1 SV=1 284 398 8.0E-07
sp|Q8TAQ2|SMRC2_HUMAN SWI/SNF complex subunit SMARCC2 OS=Homo sapiens GN=SMARCC2 PE=1 SV=1 549 603 5.0E-06
sp|Q6PDG5|SMRC2_MOUSE SWI/SNF complex subunit SMARCC2 OS=Mus musculus GN=Smarcc2 PE=1 SV=2 549 603 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4855
MEDSQLNGAEFEQKINTSGTLDRPNVEDRPMSGVMAGADEEIGDVPVNSNEPTMLGQNISAGEGHEMQSKDATEL
AARGHLMSQTHSIVLPSYSTWFDMNTIHDIERKAMAEFFNNRNRSKTPAVYKDYRDFMINTYRLNPAEYLTVTAC
RRNLAGDVCAIMRVHAFLEQWGLINYQVDADQRPSHVGPPFTGHFRIICDTPRGLQAWQPSADPVVLEGKRNIET
DRKANATTTVKSHLNLEVGRNIYEANAKTTTITKPEPKTNGDALASNGGLSTEPIAAQPMSKVNCYQCGNDCTRV
YFHSTQADPNAKADLDVCPLCFTEGRLPANHTSSMYAKIENPAYEGGSDRDAPWTDAETLRLLEGLERFDEDWAE
VSDHVGTRTREECVLRFLQLDIEEKYLGSDGPVNAPTGLSMLGSQQGHLPFSSVDNPVMSVVGFLASLANPSSTA
AAARKSADLLKQSLRKQLHGGRVEEGNEADQQEHQVGRRDGGDKNAELGKRESMDTDMRQEVIDGQRSDIMNNET
SNTTLASVPLASIGARASAFASHEEREMTRLVSAAANVTLQKLELKLKYFNELEALLRAERRELERGRQQLFLDR
LTFRRRVRQVEEKVRLSGVVGGEQGARTVHESVIAETQRLGFQLLPEESNASQLAGSDRHIRTHEV*
Coding >Hirsu2|4855
ATGGAAGACAGCCAGCTGAACGGGGCCGAATTCGAGCAGAAAATCAACACTTCCGGGACACTCGATCGACCCAAC
GTGGAAGACAGACCCATGTCCGGGGTTATGGCTGGTGCCGATGAGGAAATCGGCGATGTGCCAGTCAATTCCAAT
GAACCTACAATGTTAGGCCAAAACATCTCTGCCGGCGAAGGGCACGAAATGCAGTCAAAAGATGCTACCGAGCTG
GCAGCGCGAGGACACCTGATGTCGCAGACGCATTCGATTGTTCTACCCAGCTACAGTACTTGGTTTGATATGAAC
ACCATCCACGACATAGAACGTAAGGCCATGGCAGAGTTCTTTAACAATCGAAATAGAAGCAAAACTCCTGCAGTC
TACAAGGACTATCGCGATTTTATGATCAACACATATCGGCTAAACCCGGCGGAATATTTAACTGTGACAGCCTGT
CGACGGAATCTGGCCGGCGATGTCTGTGCCATCATGCGAGTGCATGCATTTTTGGAACAATGGGGCCTGATAAAC
TATCAGGTTGATGCCGATCAACGACCATCGCATGTTGGACCTCCCTTCACCGGCCACTTCCGAATTATTTGCGAC
ACCCCTCGTGGACTTCAAGCCTGGCAGCCCTCTGCCGATCCAGTCGTGTTAGAAGGGAAAAGGAACATCGAAACA
GATAGGAAGGCAAATGCAACGACTACGGTCAAAAGCCATCTAAACCTCGAAGTTGGTCGTAATATATACGAGGCT
AATGCAAAAACAACCACAATTACCAAGCCTGAACCCAAGACGAATGGAGACGCGCTTGCGTCAAATGGGGGGCTT
AGCACGGAACCTATTGCCGCACAGCCCATGTCGAAAGTCAACTGTTATCAATGTGGGAATGACTGCACGCGCGTT
TATTTCCACAGCACGCAAGCAGATCCCAACGCCAAGGCTGATCTCGACGTTTGCCCATTGTGTTTTACCGAAGGC
CGATTACCCGCAAATCATACGTCAAGCATGTACGCAAAGATTGAGAACCCAGCCTACGAAGGTGGCTCGGACCGG
GATGCCCCTTGGACTGATGCCGAAACACTCCGGTTACTCGAAGGACTTGAAAGATTCGATGAAGATTGGGCAGAA
GTTTCAGACCACGTGGGTACCAGGACTCGCGAGGAATGCGTCTTGCGATTCCTTCAACTGGACATTGAAGAGAAA
TACCTGGGTTCGGACGGCCCTGTCAATGCGCCGACGGGGCTTTCAATGCTCGGTTCTCAACAGGGCCATTTGCCA
TTCAGCTCGGTGGATAATCCCGTAATGTCCGTGGTGGGCTTCCTGGCAAGCCTGGCGAACCCTTCTAGCACAGCC
GCTGCAGCACGGAAATCAGCCGATCTTTTGAAACAGAGTCTACGGAAGCAGCTGCATGGCGGACGGGTCGAGGAG
GGCAATGAGGCTGACCAGCAGGAACATCAAGTCGGCAGGCGCGATGGCGGAGACAAAAACGCCGAACTGGGCAAG
CGTGAATCGATGGACACGGACATGCGCCAGGAGGTAATTGATGGTCAAAGGAGCGACATAATGAATAACGAGACT
TCAAACACTACACTTGCGTCGGTACCACTGGCGTCCATCGGAGCTCGAGCTTCCGCGTTTGCCTCGCACGAGGAG
CGTGAGATGACACGTTTGGTATCAGCGGCAGCAAATGTGACACTTCAAAAATTAGAACTGAAGCTGAAGTATTTC
AATGAATTGGAAGCCTTACTGCGGGCGGAGCGAAGGGAGTTGGAGCGAGGACGGCAACAACTGTTCTTGGACCGT
CTCACATTCAGGAGGAGGGTGCGGCAGGTCGAGGAGAAAGTAAGACTGTCAGGTGTCGTGGGAGGCGAGCAGGGG
GCGCGTACAGTGCACGAATCGGTCATTGCTGAGACACAGAGACTAGGCTTTCAGCTCTTACCTGAGGAGTCTAAT
GCTTCGCAGCTTGCTGGCAGCGATAGGCACATTCGGACACATGAGGTATAA
Transcript >Hirsu2|4855
ATGGAAGACAGCCAGCTGAACGGGGCCGAATTCGAGCAGAAAATCAACACTTCCGGGACACTCGATCGACCCAAC
GTGGAAGACAGACCCATGTCCGGGGTTATGGCTGGTGCCGATGAGGAAATCGGCGATGTGCCAGTCAATTCCAAT
GAACCTACAATGTTAGGCCAAAACATCTCTGCCGGCGAAGGGCACGAAATGCAGTCAAAAGATGCTACCGAGCTG
GCAGCGCGAGGACACCTGATGTCGCAGACGCATTCGATTGTTCTACCCAGCTACAGTACTTGGTTTGATATGAAC
ACCATCCACGACATAGAACGTAAGGCCATGGCAGAGTTCTTTAACAATCGAAATAGAAGCAAAACTCCTGCAGTC
TACAAGGACTATCGCGATTTTATGATCAACACATATCGGCTAAACCCGGCGGAATATTTAACTGTGACAGCCTGT
CGACGGAATCTGGCCGGCGATGTCTGTGCCATCATGCGAGTGCATGCATTTTTGGAACAATGGGGCCTGATAAAC
TATCAGGTTGATGCCGATCAACGACCATCGCATGTTGGACCTCCCTTCACCGGCCACTTCCGAATTATTTGCGAC
ACCCCTCGTGGACTTCAAGCCTGGCAGCCCTCTGCCGATCCAGTCGTGTTAGAAGGGAAAAGGAACATCGAAACA
GATAGGAAGGCAAATGCAACGACTACGGTCAAAAGCCATCTAAACCTCGAAGTTGGTCGTAATATATACGAGGCT
AATGCAAAAACAACCACAATTACCAAGCCTGAACCCAAGACGAATGGAGACGCGCTTGCGTCAAATGGGGGGCTT
AGCACGGAACCTATTGCCGCACAGCCCATGTCGAAAGTCAACTGTTATCAATGTGGGAATGACTGCACGCGCGTT
TATTTCCACAGCACGCAAGCAGATCCCAACGCCAAGGCTGATCTCGACGTTTGCCCATTGTGTTTTACCGAAGGC
CGATTACCCGCAAATCATACGTCAAGCATGTACGCAAAGATTGAGAACCCAGCCTACGAAGGTGGCTCGGACCGG
GATGCCCCTTGGACTGATGCCGAAACACTCCGGTTACTCGAAGGACTTGAAAGATTCGATGAAGATTGGGCAGAA
GTTTCAGACCACGTGGGTACCAGGACTCGCGAGGAATGCGTCTTGCGATTCCTTCAACTGGACATTGAAGAGAAA
TACCTGGGTTCGGACGGCCCTGTCAATGCGCCGACGGGGCTTTCAATGCTCGGTTCTCAACAGGGCCATTTGCCA
TTCAGCTCGGTGGATAATCCCGTAATGTCCGTGGTGGGCTTCCTGGCAAGCCTGGCGAACCCTTCTAGCACAGCC
GCTGCAGCACGGAAATCAGCCGATCTTTTGAAACAGAGTCTACGGAAGCAGCTGCATGGCGGACGGGTCGAGGAG
GGCAATGAGGCTGACCAGCAGGAACATCAAGTCGGCAGGCGCGATGGCGGAGACAAAAACGCCGAACTGGGCAAG
CGTGAATCGATGGACACGGACATGCGCCAGGAGGTAATTGATGGTCAAAGGAGCGACATAATGAATAACGAGACT
TCAAACACTACACTTGCGTCGGTACCACTGGCGTCCATCGGAGCTCGAGCTTCCGCGTTTGCCTCGCACGAGGAG
CGTGAGATGACACGTTTGGTATCAGCGGCAGCAAATGTGACACTTCAAAAATTAGAACTGAAGCTGAAGTATTTC
AATGAATTGGAAGCCTTACTGCGGGCGGAGCGAAGGGAGTTGGAGCGAGGACGGCAACAACTGTTCTTGGACCGT
CTCACATTCAGGAGGAGGGTGCGGCAGGTCGAGGAGAAAGTAAGACTGTCAGGTGTCGTGGGAGGCGAGCAGGGG
GCGCGTACAGTGCACGAATCGGTCATTGCTGAGACACAGAGACTAGGCTTTCAGCTCTTACCTGAGGAGTCTAAT
GCTTCGCAGCTTGCTGGCAGCGATAGGCACATTCGGACACATGAGGTATAA
Gene >Hirsu2|4855
ATGGAAGACAGCCAGCTGAACGGGGCCGAATTCGAGCAGAAAATCAACACTTCCGGGACACTCGATCGACCCAAC
GTGGAAGACAGACCCATGTCCGGGGTTATGGCTGGTGCCGATGAGGAAATCGGCGATGTGCCAGTCAATTCCAAT
GAACCTACAATGTTAGGCCAAAACATCTCTGCCGGCGAAGGGCACGAAATGCAGTCAAAAGATGCTACCGAGCTG
GCAGCGCGAGGACACCTGATGTCGCAGACGCATTCGATTGTTCTACCCAGCTACAGTACTTGGTTTGATATGAAC
ACCATCCACGACATAGAACGTAAGGCCATGGCAGAGTTCTTTAACAATCGAAATAGAAGCAAAACTCCTGCAGTC
TACAAGGACTATCGCGATTTTATGATCAACACATATCGGCTAAACCCGGCGGAATATTTAACTGTGACAGCCTGT
CGACGGAATCTGGCCGGCGATGTCTGTGCCATCATGCGAGTGCATGCATTTTTGGAACAATGGGGCCTGATAAAC
TATCAGGTATGTCCAGTTGCTAAAATATGCGTCTCTCAGTCGCCACCAGCCACCTACGTCAACCCCGTATCACAT
CTTGGGGGCTGAACGGCGGCCGAGAGCCCGAGCAAGGTTTGTGTCTGGTCATTCTATACTCACCAGAAACAGGTT
GATGCCGATCAACGACCATCGCATGTTGGACCTCCCTTCACCGGCCACTTCCGAATTATTTGCGACACCCCTCGT
GGACTTCAAGCCTGGCAGCCCTCTGCCGATCCAGTCGTGTTAGAAGGGAAAAGGAACATCGAAACAGATAGGAAG
GCAAATGCAACGACTACGGTCAAAAGCCATCTAAACCTCGAAGTTGGTCGTAATATATACGAGGCTAATGCAAAA
ACAACCACAATTACCAAGCCTGAACCCAAGACGAATGGAGACGCGCTTGCGTCAAATGGGGGGCTTAGCACGGAA
CCTATTGCCGCACAGCCCATGTCGAAAGTCAACTGTTATCAATGTGGGAATGACTGCACGCGCGTTTATTTCCAC
AGCACGCAAGCAGATCCCAACGCCAAGGCTGATCTCGACGTTTGCCCATTGTGTTTTACCGAAGGCCGATTACCC
GCAAATCATACGTCAAGCATGTACGCAAAGATTGAGAACCCAGCCTACGAAGGTGGCTCGGACCGGGATGCCCCT
TGGACTGATGCCGAAACACTCCGGTTACTCGAAGGACTTGAAAGATTCGATGAAGATTGGGCAGAAGTTTCAGAC
CACGTGGGTACCAGGACTCGCGAGGAATGCGTCTTGCGATTCCTTCAACTGGACATTGAAGAGAAATACCTGGGT
TCGGACGGCCCTGTCAATGCGCCGACGGGGCTTTCAATGCTCGGTTCTCAACAGGGCCATTTGCCATTCAGCTCG
GTGGATAATCCCGTAATGTCCGTGGTGGGCTTCCTGGCAAGCCTGGCGAACCCTTCTAGCACAGCCGCTGCAGCA
CGGAAATCAGCCGATCTTTTGAAACAGAGTCTACGGAAGCAGCTGCATGGCGGACGGGTCGAGGAGGGCAATGAG
GCTGACCAGCAGGAACATCAAGTCGGCAGGCGCGATGGCGGAGACAAAAACGCCGAACTGGGCAAGCGTGAATCG
ATGGACACGGACATGCGCCAGGAGGTAATTGATGGTCAAAGGAGCGACATAATGAATAACGAGACTTCAAACACT
ACACTTGCGTCGGTACCACTGGCGTCCATCGGAGCTCGAGCTTCCGCGTTTGCCTCGCACGAGGAGCGTGAGATG
ACACGTTTGGTATCAGCGGCAGCAAATGTGACACTTCAAAAATTAGAACTGAAGCTGAAGTATTTCAATGAATTG
GAAGCCTTACTGCGGGCGGAGCGAAGGGAGTTGGAGCGAGGACGGCAACAACTGTTCTTGGACCGTCTCACATTC
AGGAGGAGGGTGCGGCAGGTCGAGGAGAAAGTAAGACTGTCAGGTGTCGTGGGAGGCGAGCAGGGGGCGCGTACA
GTGCACGAATCGGTCATTGCTGAGACACAGAGACTAGGCTTTCAGCTCTTACCTGAGGAGTCTAATGCTTCGCAG
CTTGCTGGCAGCGATAGGCACATTCGGACACATGAGGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail