Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4845
Gene name
LocationContig_244:9020..10550
Strand-
Gene length (bp)1530
Transcript length (bp)1401
Coding sequence length (bp)1401
Protein length (aa) 467

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13344 Hydrolase_6 Haloacid dehalogenase-like hydrolase 4.5E-20 84 189
PF13242 Hydrolase_like HAD-hyrolase-like 5.6E-19 346 444

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P36151|YK50_YEAST Uncharacterized protein YKR070W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKR070W PE=1 SV=1 82 449 1.0E-56
sp|O13899|YF38_SCHPO Uncharacterized CDP-alcohol phosphatidyltransferase class-I family protein C22A12.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22A12.08c PE=3 SV=1 80 449 5.0E-51
sp|Q9BXW7|CECR5_HUMAN Cat eye syndrome critical region protein 5 OS=Homo sapiens GN=CECR5 PE=1 SV=1 84 404 7.0E-32
sp|Q91WM2|CECR5_MOUSE Cat eye syndrome critical region protein 5 homolog OS=Mus musculus GN=Cecr5 PE=1 SV=1 84 431 2.0E-30

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1088 0.111 0.0602 0.0594 0.9255 0.0676 0.0636 0.0483 0.133 0.0093

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2904
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6476
Ophiocordyceps australis map64 (Brazil) OphauB2|857
Ophiocordyceps camponoti-floridani Ophcf2|03816
Ophiocordyceps camponoti-rufipedis Ophun1|1162
Ophiocordyceps kimflemingae Ophio5|3607
Ophiocordyceps subramaniannii Hirsu2|4845 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4845
MARASVRCLASLGSGARPRVGAHTSGPTAGRTAPRPCAPYGGERPFCSTEIRREKPRGAEPGGASAAEAVPSGKA
SHVFSDVAFAFDIDGVLYRGSQGIPGAREVLRRIRSLGMRYVFLTNGGGAHEDAKVESLTKRLQMSREDDVIRNR
VIVSHTPMRDWADSVKKQTVLITGSHPETARELANQYGFTRAVTPADLIHANDKIYPFDQMKDGFHARHRPLPDG
KSASSITDPYSQDVPADALKVDQILVWNDPRDWSLDIQIIHDLLVSRGGYLGTVSDKNGDASLPNRGWQQDGQPK
LWISNLDLVWKTEFPVNRFGTGAFVEALRGVWSAVTGGAELQFEALGKPSKYTYDYAHRRLLRYYADMAPGGKPA
ADTEERPLRRVYMIGDNPESDIRGANEFEAEDGTEWLPILVRTGVWRQTATEREPRHRPAVIVDDVVDAIVWALR
NEGVDATRDGLVSGRH*
Coding >Hirsu2|4845
ATGGCTCGTGCTAGCGTGAGATGCCTCGCCAGCCTCGGCTCCGGCGCCCGCCCAAGGGTTGGAGCGCACACTTCC
GGCCCAACGGCCGGCCGAACAGCGCCGCGTCCCTGCGCGCCGTACGGCGGGGAGCGACCCTTCTGCAGCACCGAG
ATCCGGCGTGAGAAGCCGAGGGGCGCCGAGCCGGGCGGCGCTTCTGCGGCTGAGGCTGTGCCGTCCGGCAAGGCC
TCGCACGTGTTTTCGGATGTGGCGTTTGCTTTTGACATCGATGGCGTTCTGTACCGCGGCAGCCAGGGCATCCCC
GGGGCGCGAGAGGTGCTCCGGCGCATCCGCTCCCTCGGCATGCGCTACGTCTTCCTCACCAACGGCGGCGGCGCT
CATGAGGATGCCAAAGTCGAGTCTCTGACGAAACGGCTTCAGATGTCGCGGGAGGATGATGTGATTCGGAACAGG
GTCATCGTCTCTCACACGCCCATGCGCGACTGGGCCGACTCCGTCAAGAAGCAGACGGTGCTGATTACGGGATCA
CATCCCGAGACGGCCCGGGAGCTCGCCAATCAGTACGGCTTCACGCGGGCTGTGACGCCGGCGGACCTCATCCAT
GCCAACGACAAGATCTACCCCTTCGATCAGATGAAGGACGGCTTCCACGCCCGTCACCGGCCGCTCCCCGACGGC
AAGTCAGCCTCAAGCATCACGGACCCGTACAGCCAGGACGTTCCGGCGGATGCGCTCAAGGTCGACCAGATCCTG
GTGTGGAACGACCCTCGCGACTGGTCTCTCGACATCCAGATCATCCACGACCTCCTGGTGTCCCGGGGCGGCTAC
CTCGGCACCGTCTCCGACAAGAACGGCGACGCCTCCCTGCCCAACCGCGGATGGCAGCAGGACGGGCAGCCCAAG
CTCTGGATCTCGAACCTCGACCTGGTGTGGAAGACGGAGTTCCCCGTCAACAGGTTCGGCACCGGGGCCTTCGTG
GAGGCGCTGAGAGGCGTGTGGTCGGCCGTGACGGGCGGCGCGGAGCTCCAGTTCGAGGCCCTGGGCAAGCCATCC
AAGTACACGTACGACTACGCCCACCGGCGGCTACTCCGCTACTACGCGGACATGGCGCCGGGCGGCAAGCCGGCG
GCGGATACCGAGGAGCGCCCGCTCCGGCGGGTTTACATGATCGGGGACAACCCCGAGAGCGACATCCGCGGGGCC
AATGAGTTCGAGGCCGAGGACGGCACCGAGTGGCTTCCGATCCTCGTGCGGACCGGCGTCTGGAGGCAGACGGCG
ACGGAGAGGGAGCCCCGTCACAGGCCGGCTGTCATCGTCGACGACGTGGTCGATGCCATTGTTTGGGCCCTGCGG
AACGAAGGCGTAGACGCGACAAGAGACGGGCTGGTGTCTGGGAGACACTGA
Transcript >Hirsu2|4845
ATGGCTCGTGCTAGCGTGAGATGCCTCGCCAGCCTCGGCTCCGGCGCCCGCCCAAGGGTTGGAGCGCACACTTCC
GGCCCAACGGCCGGCCGAACAGCGCCGCGTCCCTGCGCGCCGTACGGCGGGGAGCGACCCTTCTGCAGCACCGAG
ATCCGGCGTGAGAAGCCGAGGGGCGCCGAGCCGGGCGGCGCTTCTGCGGCTGAGGCTGTGCCGTCCGGCAAGGCC
TCGCACGTGTTTTCGGATGTGGCGTTTGCTTTTGACATCGATGGCGTTCTGTACCGCGGCAGCCAGGGCATCCCC
GGGGCGCGAGAGGTGCTCCGGCGCATCCGCTCCCTCGGCATGCGCTACGTCTTCCTCACCAACGGCGGCGGCGCT
CATGAGGATGCCAAAGTCGAGTCTCTGACGAAACGGCTTCAGATGTCGCGGGAGGATGATGTGATTCGGAACAGG
GTCATCGTCTCTCACACGCCCATGCGCGACTGGGCCGACTCCGTCAAGAAGCAGACGGTGCTGATTACGGGATCA
CATCCCGAGACGGCCCGGGAGCTCGCCAATCAGTACGGCTTCACGCGGGCTGTGACGCCGGCGGACCTCATCCAT
GCCAACGACAAGATCTACCCCTTCGATCAGATGAAGGACGGCTTCCACGCCCGTCACCGGCCGCTCCCCGACGGC
AAGTCAGCCTCAAGCATCACGGACCCGTACAGCCAGGACGTTCCGGCGGATGCGCTCAAGGTCGACCAGATCCTG
GTGTGGAACGACCCTCGCGACTGGTCTCTCGACATCCAGATCATCCACGACCTCCTGGTGTCCCGGGGCGGCTAC
CTCGGCACCGTCTCCGACAAGAACGGCGACGCCTCCCTGCCCAACCGCGGATGGCAGCAGGACGGGCAGCCCAAG
CTCTGGATCTCGAACCTCGACCTGGTGTGGAAGACGGAGTTCCCCGTCAACAGGTTCGGCACCGGGGCCTTCGTG
GAGGCGCTGAGAGGCGTGTGGTCGGCCGTGACGGGCGGCGCGGAGCTCCAGTTCGAGGCCCTGGGCAAGCCATCC
AAGTACACGTACGACTACGCCCACCGGCGGCTACTCCGCTACTACGCGGACATGGCGCCGGGCGGCAAGCCGGCG
GCGGATACCGAGGAGCGCCCGCTCCGGCGGGTTTACATGATCGGGGACAACCCCGAGAGCGACATCCGCGGGGCC
AATGAGTTCGAGGCCGAGGACGGCACCGAGTGGCTTCCGATCCTCGTGCGGACCGGCGTCTGGAGGCAGACGGCG
ACGGAGAGGGAGCCCCGTCACAGGCCGGCTGTCATCGTCGACGACGTGGTCGATGCCATTGTTTGGGCCCTGCGG
AACGAAGGCGTAGACGCGACAAGAGACGGGCTGGTGTCTGGGAGACACTGA
Gene >Hirsu2|4845
ATGGCTCGTGCTAGCGTGAGATGCCTCGCCAGCCTCGGCTCCGGCGCCCGCCCAAGGGTTGGAGCGCACACTTCC
GGCCCAACGGCCGGCCGAACAGCGCCGCGTCCCTGCGCGCCGTACGGCGGGGAGCGACCCTTCTGCAGCACCGAG
ATCCGGCGTGAGAAGCCGAGGGGCGCCGAGCCGGGCGGCGCTTCTGCGGCTGAGGCTGTGCCGTCCGGCAAGGCC
TCGCACGTGTTTTCGGATGTGGCGTTTGCTTTTGAGTGCGCAGCCGCCCCAGAGACTTCCCAGCCGCTCGAGGTG
GCGTCGCTAACGGGCCGGCAGCATCGATGGCGTTCTGTACCGCGGCAGCCAGGGCATCCCCGGGGCGCGAGAGGT
GCTCCGGCGCATCCGCTCCCTCGGCATGCGCTACGTCTTCCTCACCAACGGCGGCGGCGCTCATGAGGATGCCAA
AGTCGAGTCTCTGACGAAACGGCTTCAGATGTCGCGGGAGGATGATGTGATTCGGAACAGGGTCATCGTCTCTCA
CACGCCCATGCGCGACTGGGCCGACTCCGTCAAGAAGCAGACGGTGCTGATTACGGGATCACATCCCGAGACGGC
CCGGGAGCTCGCCAATCAGTACGTCGCGCAGCCGCTGCCTCGACCCGACTTCTCTCTGGACGGGAAACTAACAGA
GCGTCGGACAGGTACGGCTTCACGCGGGCTGTGACGCCGGCGGACCTCATCCATGCCAACGACAAGATCTACCCC
TTCGATCAGATGAAGGACGGCTTCCACGCCCGTCACCGGCCGCTCCCCGACGGCAAGTCAGCCTCAAGCATCACG
GACCCGTACAGCCAGGACGTTCCGGCGGATGCGCTCAAGGTCGACCAGATCCTGGTGTGGAACGACCCTCGCGAC
TGGTCTCTCGACATCCAGATCATCCACGACCTCCTGGTGTCCCGGGGCGGCTACCTCGGCACCGTCTCCGACAAG
AACGGCGACGCCTCCCTGCCCAACCGCGGATGGCAGCAGGACGGGCAGCCCAAGCTCTGGATCTCGAACCTCGAC
CTGGTGTGGAAGACGGAGTTCCCCGTCAACAGGTTCGGCACCGGGGCCTTCGTGGAGGCGCTGAGAGGCGTGTGG
TCGGCCGTGACGGGCGGCGCGGAGCTCCAGTTCGAGGCCCTGGGCAAGCCATCCAAGTACACGTACGACTACGCC
CACCGGCGGCTACTCCGCTACTACGCGGACATGGCGCCGGGCGGCAAGCCGGCGGCGGATACCGAGGAGCGCCCG
CTCCGGCGGGTTTACATGATCGGGGACAACCCCGAGAGCGACATCCGCGGGGCCAATGAGTTCGAGGCCGAGGAC
GGCACCGAGTGGCTTCCGATCCTCGTGCGGACCGGCGTCTGGAGGCAGACGGCGACGGAGAGGGAGCCCCGTCAC
AGGCCGGCTGTCATCGTCGACGACGTGGTCGATGCCATTGTTTGGGCCCTGCGGAACGAAGGCGTAGACGCGACA
AGAGACGGGCTGGTGTCTGGGAGACACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail