Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4842
Gene name
LocationContig_244:115..2011
Strand-
Gene length (bp)1896
Transcript length (bp)1617
Coding sequence length (bp)1617
Protein length (aa) 539

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.2E-17 7 127
PF00069 Pkinase Protein kinase domain 1.8E-35 158 289
PF07714 Pkinase_Tyr Protein tyrosine kinase 2.0E-38 10 287

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P48479|NIM1_NEUCR G2-specific protein kinase nim-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nim-1 PE=2 SV=2 1 530 0.0E+00
sp|P11837|NIMA_EMENI G2-specific protein kinase nimA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimA PE=1 SV=1 1 534 0.0E+00
sp|O13839|FIN1_SCHPO G2-specific protein kinase fin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fin1 PE=3 SV=1 5 354 7.0E-81
sp|P22209|KIN3_YEAST Serine/threonine-protein kinase KIN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN3 PE=3 SV=2 6 340 2.0E-74
sp|Q55BN8|NEK2_DICDI Probable serine/threonine-protein kinase nek2 OS=Dictyostelium discoideum GN=nek2 PE=1 SV=1 5 354 8.0E-71
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P48479|NIM1_NEUCR G2-specific protein kinase nim-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nim-1 PE=2 SV=2 1 530 0.0E+00
sp|P11837|NIMA_EMENI G2-specific protein kinase nimA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimA PE=1 SV=1 1 534 0.0E+00
sp|O13839|FIN1_SCHPO G2-specific protein kinase fin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fin1 PE=3 SV=1 5 354 7.0E-81
sp|P22209|KIN3_YEAST Serine/threonine-protein kinase KIN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN3 PE=3 SV=2 6 340 2.0E-74
sp|Q55BN8|NEK2_DICDI Probable serine/threonine-protein kinase nek2 OS=Dictyostelium discoideum GN=nek2 PE=1 SV=1 5 354 8.0E-71
sp|P51955|NEK2_HUMAN Serine/threonine-protein kinase Nek2 OS=Homo sapiens GN=NEK2 PE=1 SV=1 2 364 3.0E-70
sp|O35942|NEK2_MOUSE Serine/threonine-protein kinase Nek2 OS=Mus musculus GN=Nek2 PE=1 SV=2 7 328 4.0E-69
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 5 294 5.0E-50
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 5 288 5.0E-50
sp|P51957|NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens GN=NEK4 PE=1 SV=2 7 294 5.0E-50
sp|Q9Z1J2|NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus GN=Nek4 PE=1 SV=1 7 294 8.0E-50
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 5 288 3.0E-49
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 5 288 6.0E-49
sp|P51956|NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens GN=NEK3 PE=1 SV=2 5 298 8.0E-49
sp|Q86SG6|NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 5 310 3.0E-48
sp|Q7ZZC8|NEK9_XENLA Serine/threonine-protein kinase Nek9 OS=Xenopus laevis GN=nek9 PE=2 SV=1 4 308 2.0E-47
sp|Q91ZR4|NEK8_MOUSE Serine/threonine-protein kinase Nek8 OS=Mus musculus GN=Nek8 PE=1 SV=1 5 292 2.0E-47
sp|D3ZGQ5|NEK8_RAT Serine/threonine-protein kinase Nek8 OS=Rattus norvegicus GN=Nek8 PE=1 SV=1 5 292 2.0E-47
sp|Q90XC2|NEK8_DANRE Serine/threonine-protein kinase Nek8 OS=Danio rerio GN=nek8 PE=2 SV=1 5 288 3.0E-47
sp|Q2QMH1|NEK2_ORYSJ Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. japonica GN=NEK2 PE=2 SV=1 5 291 1.0E-46
sp|A2ZMH2|NEK2_ORYSI Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. indica GN=NEK2 PE=3 SV=1 5 291 1.0E-46
sp|Q94CU5|NEK5_ORYSJ Serine/threonine-protein kinase Nek5 OS=Oryza sativa subsp. japonica GN=NEK5 PE=3 SV=1 5 294 1.0E-46
sp|Q8RX66|NEK3_ARATH Serine/threonine-protein kinase Nek3 OS=Arabidopsis thaliana GN=NEK3 PE=2 SV=1 5 294 2.0E-46
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 5 293 8.0E-46
sp|Q9CAU7|NEK2_ARATH Serine/threonine-protein kinase Nek2 OS=Arabidopsis thaliana GN=NEK2 PE=2 SV=1 5 294 1.0E-45
sp|Q6ZEZ5|NEK3_ORYSJ Serine/threonine-protein kinase Nek3 OS=Oryza sativa subsp. japonica GN=NEK3 PE=2 SV=1 5 291 1.0E-45
sp|Q8TD19|NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 4 301 3.0E-45
sp|Q10GB1|NEK1_ORYSJ Serine/threonine-protein kinase Nek1 OS=Oryza sativa subsp. japonica GN=NEK1 PE=3 SV=1 5 291 4.0E-45
sp|Q9LT35|NEK6_ARATH Serine/threonine-protein kinase Nek6 OS=Arabidopsis thaliana GN=NEK6 PE=3 SV=1 5 291 8.0E-45
sp|Q0WPH8|NEK5_ARATH Serine/threonine-protein kinase Nek5 OS=Arabidopsis thaliana GN=NEK5 PE=1 SV=1 5 294 9.0E-45
sp|Q8RXT4|NEK4_ARATH Serine/threonine-protein kinase Nek4 OS=Arabidopsis thaliana GN=NEK4 PE=2 SV=1 5 291 1.0E-44
sp|Q60DG4|NEK4_ORYSJ Serine/threonine-protein kinase Nek4 OS=Oryza sativa subsp. japonica GN=NEK4 PE=2 SV=1 5 294 2.0E-44
sp|Q9SLI2|NEK1_ARATH Serine/threonine-protein kinase Nek1 OS=Arabidopsis thaliana GN=NEK1 PE=2 SV=2 5 291 4.0E-44
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 5 296 2.0E-42
sp|Q6YY75|NEK6_ORYSJ Serine/threonine-protein kinase Nek6 OS=Oryza sativa subsp. japonica GN=NEK6 PE=3 SV=2 5 294 3.0E-42
sp|O01775|NEKL2_CAEEL Serine/threonine-protein kinase nekl-2 OS=Caenorhabditis elegans GN=nekl-2 PE=2 SV=1 5 293 7.0E-42
sp|Q9ES74|NEK7_MOUSE Serine/threonine-protein kinase Nek7 OS=Mus musculus GN=Nek7 PE=1 SV=1 7 285 3.0E-41
sp|D3ZBE5|NEK7_RAT Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus GN=Nek7 PE=2 SV=1 7 285 3.0E-41
sp|Q8K1R7|NEK9_MOUSE Serine/threonine-protein kinase Nek9 OS=Mus musculus GN=Nek9 PE=1 SV=2 4 301 5.0E-41
sp|Q8TDX7|NEK7_HUMAN Serine/threonine-protein kinase Nek7 OS=Homo sapiens GN=NEK7 PE=1 SV=1 7 285 8.0E-41
sp|Q8NG66|NEK11_HUMAN Serine/threonine-protein kinase Nek11 OS=Homo sapiens GN=NEK11 PE=1 SV=2 6 315 8.0E-39
sp|Q8WNU8|NEK11_MACFA Serine/threonine-protein kinase Nek11 OS=Macaca fascicularis GN=NEK11 PE=2 SV=1 6 315 9.0E-39
sp|Q08942|NRKA_TRYBB Putative serine/threonine-protein kinase A OS=Trypanosoma brucei brucei GN=NRKA PE=2 SV=1 6 380 8.0E-38
sp|Q8C0Q4|NEK11_MOUSE Serine/threonine-protein kinase Nek11 OS=Mus musculus GN=Nek11 PE=2 SV=2 6 291 3.0E-37
sp|G5EFM9|NEKL3_CAEEL Serine/threonine-protein kinase nekl-3 OS=Caenorhabditis elegans GN=nekl-3 PE=1 SV=1 11 288 3.0E-37
sp|Q9ES70|NEK6_MOUSE Serine/threonine-protein kinase Nek6 OS=Mus musculus GN=Nek6 PE=1 SV=1 11 285 4.0E-37
sp|A2BD05|NEK6_PIG Serine/threonine-protein kinase Nek6 OS=Sus scrofa GN=NEK6 PE=3 SV=1 11 285 9.0E-37
sp|Q6CSX2|ATG1_KLULA Serine/threonine-protein kinase ATG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG1 PE=3 SV=1 5 325 2.0E-36
sp|P59895|NEK6_RAT Serine/threonine-protein kinase Nek6 OS=Rattus norvegicus GN=Nek6 PE=1 SV=1 11 283 2.0E-36
sp|Q9HC98|NEK6_HUMAN Serine/threonine-protein kinase Nek6 OS=Homo sapiens GN=NEK6 PE=1 SV=2 11 285 5.0E-36
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 5 293 6.0E-36
sp|Q03428|NRKB_TRYBB Putative serine/threonine-protein kinase B OS=Trypanosoma brucei brucei GN=NRKB PE=2 SV=2 6 380 6.0E-36
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 5 293 9.0E-36
sp|P84199|NEKL4_CAEEL Serine/threonine-protein kinase D1044.8 OS=Caenorhabditis elegans GN=nekl-4 PE=3 SV=2 6 296 7.0E-35
sp|Q6ZWH5|NEK10_HUMAN Serine/threonine-protein kinase Nek10 OS=Homo sapiens GN=NEK10 PE=2 SV=3 6 341 4.0E-34
sp|Q7RX99|ATG1_NEUCR Serine/threonine-protein kinase apg-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-1 PE=3 SV=2 11 293 5.0E-34
sp|Q3UGM2|NEK10_MOUSE Serine/threonine-protein kinase Nek10 OS=Mus musculus GN=Nek10 PE=2 SV=2 7 287 3.0E-33
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 5 293 6.0E-33
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 12 281 1.0E-32
sp|Q9SFB6|M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana GN=MAP3KE2 PE=2 SV=1 4 298 2.0E-32
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 13 294 5.0E-32
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 4 294 7.0E-32
sp|Q3ZDQ4|ATG1_PODAS Serine/threonine-protein kinase ATG1 OS=Podospora anserina GN=ATG1 PE=2 SV=1 11 293 1.0E-31
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 12 293 2.0E-31
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 4 298 3.0E-31
sp|Q6H9I1|ATG1_BOTFU Serine/threonine-protein kinase ATG1 OS=Botryotinia fuckeliana GN=atg1 PE=3 SV=1 11 293 5.0E-31
sp|A6RYB8|ATG1_BOTFB Serine/threonine-protein kinase atg1 OS=Botryotinia fuckeliana (strain B05.10) GN=atg1 PE=3 SV=1 11 293 5.0E-31
sp|A0A078CGE6|M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus GN=M3KE1 PE=1 SV=1 4 298 6.0E-31
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 4 323 6.0E-31
sp|G5EGQ3|MAX2_CAEEL Serine/threonine-protein kinase max-2 OS=Caenorhabditis elegans GN=max-2 PE=1 SV=1 6 314 7.0E-31
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 7 308 9.0E-31
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 4 323 9.0E-31
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 13 303 1.0E-30
sp|P53104|ATG1_YEAST Serine/threonine-protein kinase ATG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG1 PE=1 SV=1 1 328 2.0E-30
sp|A6ZU07|ATG1_YEAS7 Serine/threonine-protein kinase ATG1 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG1 PE=3 SV=1 1 328 2.0E-30
sp|Q9Y7T4|ATG1_SCHPO Serine/threonine-protein kinase atg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atg1 PE=1 SV=1 7 283 2.0E-30
sp|Q9LHI7|NEK7_ARATH Serine/threonine-protein kinase Nek7 OS=Arabidopsis thaliana GN=NEK7 PE=2 SV=1 5 294 3.0E-30
sp|P23647|FUSED_DROME Serine/threonine-protein kinase fused OS=Drosophila melanogaster GN=fu PE=1 SV=2 5 377 4.0E-30
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 6 281 4.0E-30
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 6 281 5.0E-30
sp|Q2UGZ7|ATG1_ASPOR Serine/threonine-protein kinase atg1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg1 PE=3 SV=1 6 281 5.0E-30
sp|A7KAL2|ATG1_PENRW Serine/threonine-protein kinase atg1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg1 PE=3 SV=1 6 281 6.0E-30
sp|Q8TFN2|ATG1_PICAN Serine/threonine-protein kinase ATG1 OS=Pichia angusta GN=ATG1 PE=3 SV=1 12 293 8.0E-30
sp|P87248|ATG1_COLLN Serine/threonine-protein kinase ATG1 OS=Colletotrichum lindemuthianum GN=ATG1 PE=3 SV=1 12 281 9.0E-30
sp|Q52EB3|ATG1_MAGO7 Serine/threonine-protein kinase ATG1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG1 PE=1 SV=1 12 293 9.0E-30
sp|Q0CLX3|ATG1_ASPTN Serine/threonine-protein kinase atg1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=atg1 PE=3 SV=1 3 288 2.0E-29
sp|P28582|CDPK_DAUCA Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2 6 363 2.0E-29
sp|Q4WPF2|ATG1_ASPFU Serine/threonine-protein kinase atg1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg1 PE=3 SV=1 6 281 2.0E-29
sp|Q1DN93|ATG1_COCIM Serine/threonine-protein kinase ATG1 OS=Coccidioides immitis (strain RS) GN=ATG1 PE=3 SV=1 6 281 2.0E-29
sp|Q5B4Z3|SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sepH PE=3 SV=2 7 303 2.0E-29
sp|A1CX69|ATG1_NEOFI Serine/threonine-protein kinase atg1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg1 PE=3 SV=1 6 281 2.0E-29
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 7 354 2.0E-29
sp|Q9S9V0|CDPKV_ARATH Calcium-dependent protein kinase 31 OS=Arabidopsis thaliana GN=CPK31 PE=2 SV=2 11 363 2.0E-29
sp|A8WXF6|KCC2D_CAEBR Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis briggsae GN=unc-43 PE=3 SV=1 5 293 2.0E-29
sp|Q4P0K0|ATG1_USTMA Serine/threonine-protein kinase ATG1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATG1 PE=2 SV=1 12 254 3.0E-29
sp|O62305|KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans GN=unc-43 PE=1 SV=2 5 293 4.0E-29
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 13 302 4.0E-29
sp|A1CHL6|ATG1_ASPCL Serine/threonine-protein kinase atg1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg1 PE=3 SV=1 6 281 4.0E-29
sp|Q00168|KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain OS=Drosophila melanogaster GN=CaMKII PE=1 SV=1 5 312 4.0E-29
sp|Q5BCU8|ATG1_EMENI Serine/threonine-protein kinase atg1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg1 PE=3 SV=1 7 278 4.0E-29
sp|A7F0W2|ATG1_SCLS1 Serine/threonine-protein kinase ATG1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=ATG1 PE=3 SV=1 11 322 4.0E-29
sp|A2QIL5|ATG1_ASPNC Serine/threonine-protein kinase atg1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=atg1 PE=3 SV=1 7 278 6.0E-29
sp|Q0CL79|SEPH_ASPTN Cytokinesis protein sepH OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sepH PE=3 SV=2 7 303 9.0E-29
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 6 281 1.0E-28
sp|Q54JG7|DST4_DICDI Serine/threonine-protein kinase dst4 OS=Dictyostelium discoideum GN=dst4 PE=3 SV=1 4 294 1.0E-28
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 6 281 1.0E-28
sp|Q2H6X2|ATG1_CHAGB Serine/threonine-protein kinase ATG1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATG1 PE=3 SV=1 11 293 1.0E-28
sp|P27636|CDC15_YEAST Cell division control protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC15 PE=1 SV=3 6 288 2.0E-28
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 5 289 2.0E-28
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 4 325 2.0E-28
sp|Q5A649|ATG1_CANAL Serine/threonine-protein kinase ATG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG1 PE=3 SV=1 12 281 2.0E-28
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 6 281 3.0E-28
sp|Q8WXR4|MYO3B_HUMAN Myosin-IIIb OS=Homo sapiens GN=MYO3B PE=2 SV=4 5 374 3.0E-28
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 6 281 3.0E-28
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 4 325 3.0E-28
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 4 325 4.0E-28
sp|Q6BS08|ATG1_DEBHA Serine/threonine-protein kinase ATG1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG1 PE=3 SV=2 7 293 4.0E-28
sp|A4K2M3|STK4_PAPAN Serine/threonine-protein kinase 4 OS=Papio anubis GN=STK4 PE=3 SV=1 4 325 4.0E-28
sp|P0CP71|ATG1_CRYNB Serine/threonine-protein kinase ATG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATG1 PE=3 SV=1 6 252 4.0E-28
sp|P11275|KCC2A_RAT Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Rattus norvegicus GN=Camk2a PE=1 SV=1 5 312 5.0E-28
sp|P11798|KCC2A_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus GN=Camk2a PE=1 SV=2 5 312 5.0E-28
sp|Q6PA14|STK4_XENLA Serine/threonine-protein kinase 4 OS=Xenopus laevis GN=stk4 PE=2 SV=1 4 343 5.0E-28
sp|Q5RCC4|KCC2A_PONAB Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Pongo abelii GN=CAMK2A PE=2 SV=2 5 312 5.0E-28
sp|Q9UQM7|KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Homo sapiens GN=CAMK2A PE=1 SV=2 5 312 5.0E-28
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 4 325 6.0E-28
sp|Q5ZKI0|KCC2D_CHICK Calcium/calmodulin-dependent protein kinase type II delta chain OS=Gallus gallus GN=CAMK2D PE=2 SV=1 5 312 6.0E-28
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 4 325 6.0E-28
sp|Q54QD5|NEK1_DICDI Probable serine/threonine-protein kinase nek1 OS=Dictyostelium discoideum GN=nek1 PE=3 SV=1 2 334 6.0E-28
sp|Q75CH3|ATG1_ASHGO Serine/threonine-protein kinase ATG1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG1 PE=3 SV=1 5 337 7.0E-28
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 4 325 7.0E-28
sp|P0CP70|ATG1_CRYNJ Serine/threonine-protein kinase ATG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATG1 PE=3 SV=1 6 252 7.0E-28
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 4 325 7.0E-28
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 7 505 8.0E-28
sp|Q13554|KCC2B_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens GN=CAMK2B PE=1 SV=3 5 312 8.0E-28
sp|Q802A6|STK4_SQUAC Serine/threonine-protein kinase 3/4 OS=Squalus acanthias GN=STK4 PE=2 SV=1 4 322 8.0E-28
sp|Q8TGI1|ATG1_PICPA Serine/threonine-protein kinase ATG1 OS=Komagataella pastoris GN=ATG1 PE=3 SV=1 12 293 9.0E-28
sp|Q6FL58|ATG1_CANGA Serine/threonine-protein kinase ATG1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATG1 PE=3 SV=1 6 334 9.0E-28
sp|A4K2P5|STK4_COLGU Serine/threonine-protein kinase 4 OS=Colobus guereza GN=STK4 PE=3 SV=1 4 325 1.0E-27
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 13 293 1.0E-27
sp|O55092|SLK_CAVPO STE20-like serine/threonine-protein kinase OS=Cavia porcellus GN=SLK PE=1 SV=1 1 310 1.0E-27
sp|P08413|KCC2B_RAT Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Rattus norvegicus GN=Camk2b PE=1 SV=1 5 312 1.0E-27
sp|Q8N568|DCLK2_HUMAN Serine/threonine-protein kinase DCLK2 OS=Homo sapiens GN=DCLK2 PE=2 SV=4 5 293 2.0E-27
sp|P28652|KCC2B_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Mus musculus GN=Camk2b PE=1 SV=2 5 312 2.0E-27
sp|Q0IHQ8|STK10_XENTR Serine/threonine-protein kinase 10 OS=Xenopus tropicalis GN=stk10 PE=2 SV=1 7 305 2.0E-27
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 7 294 2.0E-27
sp|Q1EG27|MYO3B_MOUSE Myosin-IIIb OS=Mus musculus GN=Myo3b PE=2 SV=2 5 309 2.0E-27
sp|D2I3C6|DCLK2_AILME Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca GN=DCLK2 PE=3 SV=1 5 293 2.0E-27
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 13 293 2.0E-27
sp|Q3MHJ9|KCC2B_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Bos taurus GN=CAMK2B PE=2 SV=1 5 312 3.0E-27
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 13 293 3.0E-27
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 6 281 3.0E-27
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 7 291 3.0E-27
sp|O08648|M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus GN=Map3k4 PE=1 SV=2 6 300 3.0E-27
sp|Q3E9C0|CDPKY_ARATH Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1 7 294 3.0E-27
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 7 288 3.0E-27
sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 6 300 4.0E-27
sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 7 294 4.0E-27
sp|O08815|SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus GN=Slk PE=1 SV=1 1 310 4.0E-27
sp|Q54DF2|MRKA_DICDI Probable serine/threonine-protein kinase MARK-A OS=Dictyostelium discoideum GN=mrkA PE=3 SV=1 7 291 4.0E-27
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 6 281 5.0E-27
sp|O77708|KCC2D_RABIT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Oryctolagus cuniculus GN=CAMK2D PE=2 SV=2 5 312 6.0E-27
sp|A8WRV1|KIN29_CAEBR Serine/threonine-protein kinase kin-29 OS=Caenorhabditis briggsae GN=kin-29 PE=3 SV=2 7 350 6.0E-27
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 5 294 6.0E-27
sp|B7ZR30|STK10_XENLA Serine/threonine-protein kinase 10-A OS=Xenopus laevis GN=stk10-a PE=1 SV=1 7 305 6.0E-27
sp|Q9H2G2|SLK_HUMAN STE20-like serine/threonine-protein kinase OS=Homo sapiens GN=SLK PE=1 SV=1 1 310 7.0E-27
sp|Q55GC2|DST2_DICDI Serine/threonine-protein kinase dst2 OS=Dictyostelium discoideum GN=dst2 PE=3 SV=1 7 305 7.0E-27
sp|Q13188|STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens GN=STK3 PE=1 SV=2 4 294 7.0E-27
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 5 294 7.0E-27
sp|Q2HJF7|KCC2D_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Bos taurus GN=CAMK2D PE=2 SV=1 5 312 7.0E-27
sp|Q6PHZ2|KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus GN=Camk2d PE=1 SV=1 5 312 8.0E-27
sp|Q13557|KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens GN=CAMK2D PE=1 SV=3 5 312 8.0E-27
sp|Q556S2|PAKH_DICDI Serine/threonine-protein kinase pakH OS=Dictyostelium discoideum GN=pakH-1 PE=3 SV=1 4 313 8.0E-27
sp|Q95266|KCC2D_PIG Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Sus scrofa GN=CAMK2D PE=2 SV=1 5 312 9.0E-27
sp|P15791|KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus GN=Camk2d PE=1 SV=1 5 312 9.0E-27
sp|Q5MPA9|DCLK2_RAT Serine/threonine-protein kinase DCLK2 OS=Rattus norvegicus GN=Dclk2 PE=1 SV=2 5 293 9.0E-27
sp|Q9S7U9|M2K2_ARATH Mitogen-activated protein kinase kinase 2 OS=Arabidopsis thaliana GN=MKK2 PE=1 SV=2 8 294 1.0E-26
sp|Q5ZJK4|STK4_CHICK Serine/threonine-protein kinase 4 OS=Gallus gallus GN=STK4 PE=2 SV=1 4 325 1.0E-26
sp|Q6PGN3|DCLK2_MOUSE Serine/threonine-protein kinase DCLK2 OS=Mus musculus GN=Dclk2 PE=1 SV=1 5 293 1.0E-26
sp|O54988|SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus GN=Slk PE=1 SV=2 1 310 1.0E-26
sp|Q9DG02|KCC2D_XENLA Calcium/calmodulin-dependent protein kinase type II delta chain OS=Xenopus laevis GN=camk2d PE=2 SV=1 5 312 1.0E-26
sp|Q6PHR2|ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens GN=ULK3 PE=1 SV=2 5 295 1.0E-26
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 13 293 1.0E-26
sp|Q6DEH3|KC2D1_DANRE Calcium/calmodulin-dependent protein kinase type II delta 1 chain OS=Danio rerio GN=camk2d1 PE=2 SV=2 5 312 1.0E-26
sp|Q6C7U0|ATG1_YARLI Serine/threonine-protein kinase ATG1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG1 PE=3 SV=1 1 293 2.0E-26
sp|Q54H45|DRKB_DICDI Probable serine/threonine-protein kinase drkB OS=Dictyostelium discoideum GN=drkB PE=3 SV=1 12 288 2.0E-26
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=3 SV=1 4 325 2.0E-26
sp|Q9IA88|SIK2_CHICK Serine/threonine-protein kinase SIK2 OS=Gallus gallus GN=SIK2 PE=2 SV=1 7 371 2.0E-26
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 7 287 2.0E-26
sp|Q54YF2|AMPKA_DICDI 5'-AMP-activated serine/threonine-protein kinase catalytic subunit alpha OS=Dictyostelium discoideum GN=snfA PE=2 SV=1 13 281 2.0E-26
sp|Q9JI10|STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus GN=Stk3 PE=1 SV=1 4 294 2.0E-26
sp|Q9C562|CIPKA_ARATH CBL-interacting serine/threonine-protein kinase 10 OS=Arabidopsis thaliana GN=CIPK10 PE=1 SV=1 5 329 2.0E-26
sp|Q13233|M3K1_HUMAN Mitogen-activated protein kinase kinase kinase 1 OS=Homo sapiens GN=MAP3K1 PE=1 SV=4 11 294 2.0E-26
sp|Q8K3H5|MYO3A_MOUSE Myosin-IIIa OS=Mus musculus GN=Myo3a PE=2 SV=1 5 342 2.0E-26
sp|O54748|STK3_RAT Serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Stk3 PE=1 SV=1 4 294 2.0E-26
sp|Q00372|SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF1 PE=3 SV=2 7 321 2.0E-26
sp|Q6DGS3|KC2D2_DANRE Calcium/calmodulin-dependent protein kinase type II delta 2 chain OS=Danio rerio GN=camk2d2 PE=2 SV=2 5 312 2.0E-26
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 13 282 2.0E-26
sp|O81472|MP3K2_ARATH Mitogen-activated protein kinase kinase kinase 9 OS=Arabidopsis thaliana GN=MEKK2 PE=1 SV=1 15 294 3.0E-26
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 7 288 3.0E-26
sp|F1NBT0|STK10_CHICK Serine/threonine-protein kinase 10 OS=Gallus gallus GN=STK10 PE=3 SV=2 7 293 3.0E-26
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 7 287 3.0E-26
sp|Q9R1U5|SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus GN=Sik1 PE=1 SV=1 7 287 3.0E-26
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 7 288 3.0E-26
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 6 281 4.0E-26
sp|P53349|M3K1_MOUSE Mitogen-activated protein kinase kinase kinase 1 OS=Mus musculus GN=Map3k1 PE=1 SV=3 11 294 4.0E-26
sp|Q62925|M3K1_RAT Mitogen-activated protein kinase kinase kinase 1 OS=Rattus norvegicus GN=Map3k1 PE=1 SV=1 11 294 4.0E-26
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 6 242 4.0E-26
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 6 242 5.0E-26
sp|A7TIZ4|ATG1_VANPO Serine/threonine-protein kinase atg1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG1 PE=3 SV=1 44 281 5.0E-26
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 7 288 5.0E-26
sp|P06782|SNF1_YEAST Carbon catabolite-derepressing protein kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF1 PE=1 SV=1 6 288 5.0E-26
sp|Q7ZUQ3|STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio GN=stk3 PE=2 SV=1 4 293 6.0E-26
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 7 288 6.0E-26
sp|P32490|MKK1_YEAST MAP kinase kinase MKK1/SSP32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKK1 PE=1 SV=1 4 310 7.0E-26
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 6 288 8.0E-26
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 6 288 8.0E-26
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 11 291 8.0E-26
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 7 302 8.0E-26
sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 7 302 9.0E-26
sp|Q21017|KIN29_CAEEL Serine/threonine-protein kinase kin-29 OS=Caenorhabditis elegans GN=kin-29 PE=1 SV=2 7 281 1.0E-25
sp|Q13555|KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens GN=CAMK2G PE=1 SV=3 5 312 1.0E-25
sp|Q6P3Q4|STK4_XENTR Serine/threonine-protein kinase 4 OS=Xenopus tropicalis GN=stk4 PE=2 SV=1 4 320 1.0E-25
sp|Q5ZJH6|ULK3_CHICK Serine/threonine-protein kinase ULK3 OS=Gallus gallus GN=ULK3 PE=2 SV=1 5 293 1.0E-25
sp|Q869T7|PAKF_DICDI Serine/threonine-protein kinase pakF OS=Dictyostelium discoideum GN=pakF PE=3 SV=1 11 309 1.0E-25
sp|Q8CFH6|SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus GN=Sik2 PE=1 SV=1 7 287 1.0E-25
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 7 281 1.0E-25
sp|Q4V7Q6|ULK3_XENLA Serine/threonine-protein kinase ULK3 OS=Xenopus laevis GN=ulk3 PE=2 SV=1 11 281 2.0E-25
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 5 294 2.0E-25
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 6 281 2.0E-25
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 6 281 2.0E-25
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 6 293 2.0E-25
sp|Q923T9|KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus GN=Camk2g PE=1 SV=1 5 312 2.0E-25
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 6 317 2.0E-25
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 6 317 2.0E-25
sp|Q7SY52|STK10_DANRE Serine/threonine-protein kinase 10 OS=Danio rerio GN=stk10 PE=2 SV=1 5 293 2.0E-25
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 4 294 2.0E-25
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 6 317 2.0E-25
sp|Q9VXE5|PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster GN=mbt PE=1 SV=2 5 310 2.0E-25
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 6 317 2.0E-25
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 6 321 2.0E-25
sp|E9PTG8|STK10_RAT Serine/threonine-protein kinase 10 OS=Rattus norvegicus GN=Stk10 PE=1 SV=1 5 310 2.0E-25
sp|O94804|STK10_HUMAN Serine/threonine-protein kinase 10 OS=Homo sapiens GN=STK10 PE=1 SV=1 7 305 3.0E-25
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 13 242 3.0E-25
sp|Q9H0K1|SIK2_HUMAN Serine/threonine-protein kinase SIK2 OS=Homo sapiens GN=SIK2 PE=1 SV=1 7 287 3.0E-25
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 6 321 3.0E-25
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 6 321 3.0E-25
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 6 321 3.0E-25
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 6 321 3.0E-25
sp|Q54B33|PAKE_DICDI Serine/threonine-protein kinase pakE OS=Dictyostelium discoideum GN=pakE PE=3 SV=1 2 316 3.0E-25
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 1 301 4.0E-25
sp|P11730|KCC2G_RAT Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Rattus norvegicus GN=Camk2g PE=1 SV=1 5 312 4.0E-25
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 7 294 4.0E-25
sp|Q3U3Q1|ULK3_MOUSE Serine/threonine-protein kinase ULK3 OS=Mus musculus GN=Ulk3 PE=2 SV=1 5 282 5.0E-25
sp|Q9ZSA2|CDPKL_ARATH Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1 7 363 5.0E-25
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 6 288 6.0E-25
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 5 294 6.0E-25
sp|P08458|SPS1_YEAST Sporulation-specific protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS1 PE=1 SV=2 13 327 6.0E-25
sp|O75385|ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens GN=ULK1 PE=1 SV=2 13 242 6.0E-25
sp|Q6ZQ29|TAOK2_MOUSE Serine/threonine-protein kinase TAO2 OS=Mus musculus GN=Taok2 PE=1 SV=3 4 305 7.0E-25
sp|Q86CS2|ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum GN=atg1 PE=3 SV=1 11 281 7.0E-25
sp|Q8NEV4|MYO3A_HUMAN Myosin-IIIa OS=Homo sapiens GN=MYO3A PE=2 SV=2 5 288 7.0E-25
sp|O14305|SID1_SCHPO Serine/threonine-protein kinase sid1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid1 PE=1 SV=1 5 305 8.0E-25
sp|Q54H46|DRKA_DICDI Probable serine/threonine-protein kinase drkA OS=Dictyostelium discoideum GN=drkA PE=3 SV=1 12 288 8.0E-25
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 2 284 8.0E-25
sp|Q10407|MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mkh1 PE=3 SV=1 11 294 8.0E-25
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 5 282 8.0E-25
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 5 288 9.0E-25
sp|Q9JLS3|TAOK2_RAT Serine/threonine-protein kinase TAO2 OS=Rattus norvegicus GN=Taok2 PE=1 SV=1 4 305 9.0E-25
sp|Q54PX0|Y4251_DICDI Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum GN=DDB_G0284251 PE=3 SV=1 6 298 9.0E-25
sp|P41892|CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc7 PE=1 SV=1 13 317 1.0E-24
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 6 321 1.0E-24
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 6 288 1.0E-24
sp|Q9UL54|TAOK2_HUMAN Serine/threonine-protein kinase TAO2 OS=Homo sapiens GN=TAOK2 PE=1 SV=2 4 305 1.0E-24
sp|Q55CA6|Y0146_DICDI Probable serine/threonine-protein kinase DDB_G0270146 OS=Dictyostelium discoideum GN=DDB_G0270146 PE=3 SV=1 13 293 1.0E-24
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 13 281 1.0E-24
sp|E1BK52|STK10_BOVIN Serine/threonine-protein kinase 10 OS=Bos taurus GN=STK10 PE=3 SV=3 7 310 1.0E-24
sp|O08875|DCLK1_RAT Serine/threonine-protein kinase DCLK1 OS=Rattus norvegicus GN=Dclk1 PE=1 SV=1 5 294 1.0E-24
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 13 316 2.0E-24
sp|P06784|STE7_YEAST Serine/threonine-protein kinase STE7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE7 PE=1 SV=1 10 288 2.0E-24
sp|O88664|TAOK1_RAT Serine/threonine-protein kinase TAO1 OS=Rattus norvegicus GN=Taok1 PE=1 SV=1 4 305 2.0E-24
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 6 281 2.0E-24
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 6 293 2.0E-24
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 5 302 2.0E-24
sp|Q5F2E8|TAOK1_MOUSE Serine/threonine-protein kinase TAO1 OS=Mus musculus GN=Taok1 PE=1 SV=1 4 305 2.0E-24
sp|D3ZHP7|ULK3_RAT Serine/threonine-protein kinase ULK3 OS=Rattus norvegicus GN=Ulk3 PE=1 SV=1 5 282 2.0E-24
sp|O55098|STK10_MOUSE Serine/threonine-protein kinase 10 OS=Mus musculus GN=Stk10 PE=1 SV=2 5 293 2.0E-24
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 5 313 2.0E-24
sp|Q7L7X3|TAOK1_HUMAN Serine/threonine-protein kinase TAO1 OS=Homo sapiens GN=TAOK1 PE=1 SV=1 4 305 3.0E-24
sp|Q06850|CDPK1_ARATH Calcium-dependent protein kinase 1 OS=Arabidopsis thaliana GN=CPK1 PE=1 SV=1 7 347 3.0E-24
sp|Q0UY20|ATG1_PHANO Serine/threonine-protein kinase atg1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG1 PE=3 SV=2 6 294 3.0E-24
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 4 327 3.0E-24
sp|Q38870|CDPK2_ARATH Calcium-dependent protein kinase 2 OS=Arabidopsis thaliana GN=CPK2 PE=1 SV=1 7 347 3.0E-24
sp|Q5REX1|SIK2_PONAB Serine/threonine-protein kinase SIK2 OS=Pongo abelii GN=SIK2 PE=2 SV=1 7 287 4.0E-24
sp|Q9LE81|IRE_ARATH Probable serine/threonine protein kinase IRE OS=Arabidopsis thaliana GN=IRE PE=2 SV=1 2 316 4.0E-24
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 13 294 4.0E-24
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 6 286 5.0E-24
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 3 287 5.0E-24
sp|Q9JLM8|DCLK1_MOUSE Serine/threonine-protein kinase DCLK1 OS=Mus musculus GN=Dclk1 PE=1 SV=1 5 293 5.0E-24
sp|Q9N2L7|PLK2_CAEEL Serine/threonine-protein kinase plk-2 OS=Caenorhabditis elegans GN=plk-2 PE=2 SV=1 6 283 5.0E-24
sp|Q6ERS0|CIPKR_ORYSJ Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1 4 294 6.0E-24
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 4 288 6.0E-24
sp|Q8IY84|NIM1_HUMAN Serine/threonine-protein kinase NIM1 OS=Homo sapiens GN=NIM1K PE=1 SV=1 12 281 6.0E-24
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 7 335 6.0E-24
sp|P32491|MKK2_YEAST MAP kinase kinase MKK2/SSP33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKK2 PE=1 SV=2 4 299 7.0E-24
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 4 305 7.0E-24
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 5 287 7.0E-24
sp|F4I1N8|ATG1T_ARATH Serine/threonine-protein kinase ATG1t OS=Arabidopsis thaliana GN=At1g49180 PE=2 SV=1 42 278 7.0E-24
sp|Q5UQG7|YR818_MIMIV Putative serine/threonine-protein kinase/receptor R818 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R818 PE=3 SV=1 7 288 8.0E-24
sp|P34101|FHKC_DICDI Probable serine/threonine-protein kinase fhkC OS=Dictyostelium discoideum GN=fhkC PE=3 SV=2 4 291 8.0E-24
sp|Q1PFH8|CDPKJ_ARATH Calcium-dependent protein kinase 19 OS=Arabidopsis thaliana GN=CPK19 PE=2 SV=1 4 356 8.0E-24
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 7 340 9.0E-24
sp|Q9Y6E0|STK24_HUMAN Serine/threonine-protein kinase 24 OS=Homo sapiens GN=STK24 PE=1 SV=1 4 288 9.0E-24
sp|Q5UQ78|YR517_MIMIV Putative serine/threonine-protein kinase R517/R518 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R517 PE=3 SV=2 46 288 1.0E-23
sp|F4HYG2|IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana GN=IRE3 PE=2 SV=1 3 281 1.0E-23
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 7 294 1.0E-23
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 7 313 1.0E-23
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 7 373 1.0E-23
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 7 254 1.0E-23
sp|P10506|BYR1_SCHPO Protein kinase byr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr1 PE=1 SV=1 8 291 1.0E-23
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 7 254 1.0E-23
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 7 287 1.0E-23
sp|Q6GPK9|TAOK2_XENLA Serine/threonine-protein kinase TAO2 OS=Xenopus laevis GN=taok2 PE=2 SV=1 4 305 1.0E-23
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 12 289 1.0E-23
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 13 288 2.0E-23
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 12 289 2.0E-23
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 7 309 2.0E-23
sp|P12370|KAPC_DROME cAMP-dependent protein kinase catalytic subunit OS=Drosophila melanogaster GN=Pka-C1 PE=1 SV=3 5 281 2.0E-23
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 13 305 2.0E-23
sp|O15075|DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens GN=DCLK1 PE=1 SV=2 5 293 2.0E-23
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 11 299 2.0E-23
sp|P22612|KAPCG_HUMAN cAMP-dependent protein kinase catalytic subunit gamma OS=Homo sapiens GN=PRKACG PE=1 SV=3 2 281 2.0E-23
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 6 288 2.0E-23
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 7 287 2.0E-23
sp|P21137|KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans GN=kin-1 PE=1 SV=3 5 281 3.0E-23
sp|Q6NU21|TAO1A_XENLA Serine/threonine-protein kinase TAO1-A OS=Xenopus laevis GN=taok1-a PE=2 SV=1 4 305 3.0E-23
sp|Q9UBS0|KS6B2_HUMAN Ribosomal protein S6 kinase beta-2 OS=Homo sapiens GN=RPS6KB2 PE=1 SV=2 7 281 3.0E-23
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 11 364 3.0E-23
sp|Q6FV07|IPL1_CANGA Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1 7 294 3.0E-23
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 4 296 3.0E-23
sp|Q9BYT3|STK33_HUMAN Serine/threonine-protein kinase 33 OS=Homo sapiens GN=STK33 PE=1 SV=1 13 288 3.0E-23
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 5 315 3.0E-23
sp|P33886|WIS1_SCHPO Protein kinase wis1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis1 PE=1 SV=1 10 305 3.0E-23
sp|Q75DK7|STE20_ASHGO Serine/threonine-protein kinase STE20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STE20 PE=3 SV=2 7 288 3.0E-23
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 7 254 3.0E-23
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 6 294 3.0E-23
sp|Q99KH8|STK24_MOUSE Serine/threonine-protein kinase 24 OS=Mus musculus GN=Stk24 PE=1 SV=1 4 288 3.0E-23
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 7 368 3.0E-23
sp|H2L099|GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans GN=gck-1 PE=1 SV=1 11 305 4.0E-23
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 12 289 4.0E-23
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 3 295 4.0E-23
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 7 281 4.0E-23
sp|Q42396|CDPKC_ARATH Calcium-dependent protein kinase 12 OS=Arabidopsis thaliana GN=CPK12 PE=1 SV=1 4 347 4.0E-23
sp|Q869N2|PAKB_DICDI Serine/threonine-protein kinase pakB OS=Dictyostelium discoideum GN=pakB PE=1 SV=1 12 294 4.0E-23
sp|B0LT89|STK24_RAT Serine/threonine-protein kinase 24 OS=Rattus norvegicus GN=Stk24 PE=2 SV=1 4 288 4.0E-23
sp|P05132|KAPCA_MOUSE cAMP-dependent protein kinase catalytic subunit alpha OS=Mus musculus GN=Prkaca PE=1 SV=3 5 281 4.0E-23
sp|Q12706|PSK1_SCHPO Serine/threonine-protein kinase psk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psk1 PE=3 SV=1 7 281 4.0E-23
sp|Q9H2K8|TAOK3_HUMAN Serine/threonine-protein kinase TAO3 OS=Homo sapiens GN=TAOK3 PE=1 SV=2 4 305 5.0E-23
sp|B2GUY1|PLK4_RAT Serine/threonine-protein kinase PLK4 OS=Rattus norvegicus GN=Plk4 PE=2 SV=1 13 293 5.0E-23
sp|Q54EY4|DST3_DICDI Serine/threonine-protein kinase dst3 OS=Dictyostelium discoideum GN=dst3 PE=3 SV=1 4 345 5.0E-23
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 6 294 5.0E-23
sp|Q8BRK8|AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus GN=Prkaa2 PE=1 SV=3 1 281 5.0E-23
sp|O95747|OXSR1_HUMAN Serine/threonine-protein kinase OSR1 OS=Homo sapiens GN=OXSR1 PE=1 SV=1 5 288 6.0E-23
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 7 286 6.0E-23
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 6 288 8.0E-23
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 6 288 8.0E-23
sp|Q5R495|OXSR1_PONAB Serine/threonine-protein kinase OSR1 OS=Pongo abelii GN=OXSR1 PE=2 SV=1 5 288 8.0E-23
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 6 288 8.0E-23
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 6 288 8.0E-23
sp|O00444|PLK4_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens GN=PLK4 PE=1 SV=3 13 293 8.0E-23
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 6 288 8.0E-23
sp|A8XJQ6|KAPC2_CAEBR cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis briggsae GN=CBG14305 PE=1 SV=2 13 281 9.0E-23
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 6 281 9.0E-23
sp|Q7ZYJ0|TAO1B_XENLA Serine/threonine-protein kinase TAO1-B OS=Xenopus laevis GN=taok1-b PE=2 SV=1 4 305 9.0E-23
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 13 310 9.0E-23
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 6 281 9.0E-23
sp|Q8BHI9|NIM1_MOUSE Serine/threonine-protein kinase NIM1 OS=Mus musculus GN=Nim1k PE=2 SV=1 12 281 1.0E-22
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 6 281 1.0E-22
sp|Q54TM7|DRKD_DICDI Probable serine/threonine-protein kinase drkD OS=Dictyostelium discoideum GN=drkD PE=2 SV=1 12 299 1.0E-22
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 8 299 1.0E-22
sp|Q64702|PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus GN=Plk4 PE=1 SV=2 13 293 1.0E-22
sp|Q863I2|OXSR1_PIG Serine/threonine-protein kinase OSR1 OS=Sus scrofa GN=OXSR1 PE=2 SV=1 3 288 1.0E-22
sp|F1LP90|MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus GN=Mink1 PE=1 SV=2 7 322 1.0E-22
sp|A5A7I8|CDPK5_SOLTU Calcium-dependent protein kinase 5 OS=Solanum tuberosum GN=CPK5 PE=2 SV=1 5 363 1.0E-22
sp|Q9JM52|MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus GN=Mink1 PE=1 SV=3 7 322 1.0E-22
sp|Q8N4C8|MINK1_HUMAN Misshapen-like kinase 1 OS=Homo sapiens GN=MINK1 PE=1 SV=2 7 322 1.0E-22
sp|Q55GV3|PAKC_DICDI Serine/threonine-protein kinase pakC OS=Dictyostelium discoideum GN=pakC PE=1 SV=2 7 295 1.0E-22
sp|Q5R9Z7|PLK4_PONAB Serine/threonine-protein kinase PLK4 OS=Pongo abelii GN=PLK4 PE=2 SV=1 13 293 1.0E-22
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 6 329 1.0E-22
sp|Q3SWY6|STK25_BOVIN Serine/threonine-protein kinase 25 OS=Bos taurus GN=STK25 PE=2 SV=1 4 288 2.0E-22
sp|Q09137|AAPK2_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus GN=Prkaa2 PE=1 SV=1 1 281 2.0E-22
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 6 288 2.0E-22
sp|A2VDZ4|PLK4_BOVIN Serine/threonine-protein kinase PLK4 OS=Bos taurus GN=PLK4 PE=2 SV=1 13 293 2.0E-22
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 4 328 2.0E-22
sp|Q5QN75|M2K1_ORYSJ Mitogen-activated protein kinase kinase 1 OS=Oryza sativa subsp. japonica GN=MKK1 PE=1 SV=1 3 317 2.0E-22
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 5 294 2.0E-22
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 6 288 2.0E-22
sp|P36887|KAPCA_PIG cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa GN=PRKACA PE=1 SV=4 5 281 2.0E-22
sp|Q8BYC6|TAOK3_MOUSE Serine/threonine-protein kinase TAO3 OS=Mus musculus GN=Taok3 PE=1 SV=2 4 305 2.0E-22
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 6 281 2.0E-22
sp|Q53UA7|TAOK3_RAT Serine/threonine-protein kinase TAO3 OS=Rattus norvegicus GN=Taok3 PE=1 SV=1 4 305 2.0E-22
sp|P27791|KAPCA_RAT cAMP-dependent protein kinase catalytic subunit alpha OS=Rattus norvegicus GN=Prkaca PE=1 SV=2 5 281 2.0E-22
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 3 294 2.0E-22
sp|P25321|KAPCA_CRIGR cAMP-dependent protein kinase catalytic subunit alpha OS=Cricetulus griseus GN=PRKACA PE=1 SV=2 5 281 2.0E-22
sp|Q9I9E0|TAOK3_CHICK Serine/threonine-protein kinase TAO3 OS=Gallus gallus GN=TAOK3 PE=2 SV=2 4 305 3.0E-22
sp|Q9UEW8|STK39_HUMAN STE20/SPS1-related proline-alanine-rich protein kinase OS=Homo sapiens GN=STK39 PE=1 SV=3 5 323 3.0E-22
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 6 291 3.0E-22
sp|P08018|PBS2_YEAST MAP kinase kinase PBS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PBS2 PE=1 SV=4 5 326 3.0E-22
sp|Q6P9R2|OXSR1_MOUSE Serine/threonine-protein kinase OSR1 OS=Mus musculus GN=Oxsr1 PE=1 SV=1 5 323 3.0E-22
sp|O00506|STK25_HUMAN Serine/threonine-protein kinase 25 OS=Homo sapiens GN=STK25 PE=1 SV=1 4 288 3.0E-22
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 6 288 3.0E-22
sp|O88506|STK39_RAT STE20/SPS1-related proline-alanine-rich protein kinase OS=Rattus norvegicus GN=Stk39 PE=1 SV=2 5 323 3.0E-22
sp|P54646|AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens GN=PRKAA2 PE=1 SV=2 1 281 3.0E-22
sp|Q28948|AAPK2_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Sus scrofa GN=PRKAA2 PE=2 SV=2 1 281 3.0E-22
sp|Q9Z1W9|STK39_MOUSE STE20/SPS1-related proline-alanine-rich protein kinase OS=Mus musculus GN=Stk39 PE=1 SV=1 5 323 4.0E-22
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 7 286 4.0E-22
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 5 286 4.0E-22
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 13 330 4.0E-22
sp|Q8BTW9|PAK4_MOUSE Serine/threonine-protein kinase PAK 4 OS=Mus musculus GN=Pak4 PE=1 SV=1 8 312 5.0E-22
sp|Q9Z2W1|STK25_MOUSE Serine/threonine-protein kinase 25 OS=Mus musculus GN=Stk25 PE=1 SV=2 4 288 5.0E-22
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 14 282 5.0E-22
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 7 368 5.0E-22
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 11 295 5.0E-22
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 8 299 5.0E-22
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 8 299 5.0E-22
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 10 293 5.0E-22
sp|P17612|KAPCA_HUMAN cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens GN=PRKACA PE=1 SV=2 5 281 6.0E-22
sp|Q5XHI9|HUNKA_XENLA Hormonally up-regulated neu tumor-associated kinase homolog A OS=Xenopus laevis GN=hunk-a PE=2 SV=1 12 289 6.0E-22
sp|P50530|SCK1_SCHPO Serine/threonine-protein kinase sck1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sck1 PE=1 SV=2 7 287 6.0E-22
sp|Q7JP68|KAPC2_CAEEL cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis elegans GN=F47F2.1 PE=1 SV=1 13 281 6.0E-22
sp|A8XW88|KAPC1_CAEBR cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis briggsae GN=kin-1 PE=1 SV=1 5 281 6.0E-22
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 7 317 6.0E-22
sp|B1WAS2|HUNK_XENTR Hormonally up-regulated neu tumor-associated kinase homolog OS=Xenopus tropicalis GN=hunk PE=2 SV=1 49 289 7.0E-22
sp|Q8MJ44|KAPCA_CANLF cAMP-dependent protein kinase catalytic subunit alpha OS=Canis lupus familiaris GN=PRKACA PE=1 SV=3 5 281 7.0E-22
sp|O14047|PPK11_SCHPO Serine/threonine-protein kinase ppk11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk11 PE=3 SV=1 6 288 7.0E-22
sp|Q93VK0|PPCK2_ARATH Phosphoenolpyruvate carboxylase kinase 2 OS=Arabidopsis thaliana GN=PPCK2 PE=1 SV=2 4 255 7.0E-22
sp|P52304|POLO_DROME Serine/threonine-protein kinase polo OS=Drosophila melanogaster GN=polo PE=1 SV=2 41 294 8.0E-22
sp|P18961|YPK2_YEAST Serine/threonine-protein kinase YPK2/YKR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK2 PE=1 SV=1 3 281 8.0E-22
sp|Q54PB4|MYLKE_DICDI Probable myosin light chain kinase DDB_G0284661 OS=Dictyostelium discoideum GN=DDB_G0284661 PE=3 SV=1 5 289 8.0E-22
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 6 281 8.0E-22
sp|O94168|SNF1_CANTR Carbon catabolite-derepressing protein kinase OS=Candida tropicalis GN=SNF1 PE=3 SV=1 6 281 1.0E-21
sp|O75011|NAK1_SCHPO Serine/threonine-protein kinase nak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nak1 PE=1 SV=1 7 288 1.0E-21
sp|Q5RD00|AAPK2_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Pongo abelii GN=PRKAA2 PE=2 SV=1 1 281 1.0E-21
sp|P46549|SULU_CAEEL Serine/threonine-protein kinase SULU OS=Caenorhabditis elegans GN=kin-18 PE=2 SV=1 4 305 1.0E-21
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 5 288 1.0E-21
sp|Q9SJ61|CDPKP_ARATH Calcium-dependent protein kinase 25 OS=Arabidopsis thaliana GN=CPK25 PE=2 SV=1 7 294 1.0E-21
sp|O80396|M2K3_ARATH Mitogen-activated protein kinase kinase 3 OS=Arabidopsis thaliana GN=MKK3 PE=1 SV=1 13 305 1.0E-21
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 13 281 1.0E-21
sp|G5EFU0|PK2_CAEEL Serine/threonine-protein kinase pak-2 OS=Caenorhabditis elegans GN=pak-2 PE=2 SV=1 11 291 1.0E-21
sp|Q6VZ17|HUNKB_XENLA Hormonally up-regulated neu tumor-associated kinase homolog B (Fragment) OS=Xenopus laevis GN=hunk-b PE=2 SV=1 49 289 1.0E-21
sp|Q6NLQ6|CDPKW_ARATH Calcium-dependent protein kinase 32 OS=Arabidopsis thaliana GN=CPK32 PE=1 SV=1 4 360 1.0E-21
sp|Q9Z1M4|KS6B2_MOUSE Ribosomal protein S6 kinase beta-2 OS=Mus musculus GN=Rps6kb2 PE=1 SV=1 7 281 1.0E-21
sp|Q4FZD7|PLK5_MOUSE Inactive serine/threonine-protein kinase PLK5 OS=Mus musculus GN=Plk5 PE=1 SV=1 13 288 1.0E-21
sp|P54644|KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum GN=pkbA PE=1 SV=1 7 281 1.0E-21
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 10 287 1.0E-21
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 10 287 1.0E-21
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 10 287 1.0E-21
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 13 281 1.0E-21
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 5 315 2.0E-21
sp|Q8SWM6|CDC5_ENCCU Probable cell cycle serine/threonine-protein kinase CDC5 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC5 PE=3 SV=2 44 288 2.0E-21
sp|Q6DD27|TAOK3_XENLA Serine/threonine-protein kinase TAO3 OS=Xenopus laevis GN=taok3 PE=2 SV=1 10 305 2.0E-21
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 14 282 2.0E-21
sp|Q9FJV0|M2K6_ARATH Mitogen-activated protein kinase kinase 6 OS=Arabidopsis thaliana GN=MKK6 PE=1 SV=1 1 305 2.0E-21
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 6 312 2.0E-21
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 6 281 2.0E-21
sp|P45894|AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans GN=aak-1 PE=2 SV=2 11 374 2.0E-21
sp|P93759|CDPKE_ARATH Calcium-dependent protein kinase 14 OS=Arabidopsis thaliana GN=CPK14 PE=2 SV=1 6 312 2.0E-21
sp|Q96J92|WNK4_HUMAN Serine/threonine-protein kinase WNK4 OS=Homo sapiens GN=WNK4 PE=1 SV=1 6 281 2.0E-21
sp|P49673|KAPC_ASCSU cAMP-dependent protein kinase catalytic subunit OS=Ascaris suum GN=CAPK PE=2 SV=1 5 281 2.0E-21
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 6 295 2.0E-21
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 6 310 2.0E-21
sp|Q7TPK6|WNK4_RAT Serine/threonine-protein kinase WNK4 OS=Rattus norvegicus GN=Wnk4 PE=1 SV=3 6 281 2.0E-21
sp|Q17850|PK1_CAEEL Serine/threonine-protein kinase pak-1 OS=Caenorhabditis elegans GN=pak-1 PE=1 SV=2 6 294 2.0E-21
sp|Q7XIW5|CIPKT_ORYSJ CBL-interacting protein kinase 29 OS=Oryza sativa subsp. japonica GN=CIPK29 PE=2 SV=1 41 294 2.0E-21
sp|Q9U1Y5|CHK2_CAEEL Serine/threonine-protein kinase chk-2 OS=Caenorhabditis elegans GN=chk-2 PE=2 SV=2 9 288 2.0E-21
sp|Q20845|PLK3_CAEEL Serine/threonine-protein kinase plk-3 OS=Caenorhabditis elegans GN=plk-3 PE=2 SV=1 48 324 2.0E-21
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 6 281 3.0E-21
sp|Q80UE6|WNK4_MOUSE Serine/threonine-protein kinase WNK4 OS=Mus musculus GN=Wnk4 PE=1 SV=1 6 281 3.0E-21
sp|Q5R4F3|TAOK3_PONAB Serine/threonine-protein kinase TAO3 OS=Pongo abelii GN=TAOK3 PE=2 SV=1 4 305 3.0E-21
sp|O09110|MP2K3_MOUSE Dual specificity mitogen-activated protein kinase kinase 3 OS=Mus musculus GN=Map2k3 PE=1 SV=2 5 300 3.0E-21
sp|A5A7I7|CDPK4_SOLTU Calcium-dependent protein kinase 4 OS=Solanum tuberosum GN=CPK4 PE=2 SV=1 5 363 3.0E-21
sp|Q38871|CDPK5_ARATH Calcium-dependent protein kinase 5 OS=Arabidopsis thaliana GN=CPK5 PE=2 SV=1 5 363 3.0E-21
sp|Q0VD22|STK33_BOVIN Serine/threonine-protein kinase 33 OS=Bos taurus GN=STK33 PE=2 SV=1 13 288 3.0E-21
sp|Q54RV3|PAKG_DICDI Serine/threonine-protein kinase pakG OS=Dictyostelium discoideum GN=pakG PE=3 SV=1 13 303 3.0E-21
sp|Q96GD4|AURKB_HUMAN Aurora kinase B OS=Homo sapiens GN=AURKB PE=1 SV=3 5 294 3.0E-21
sp|Q9MZD9|KAPCA_SHEEP cAMP-dependent protein kinase catalytic subunit alpha OS=Ovis aries GN=PRKACA PE=1 SV=3 5 281 3.0E-21
sp|Q54P26|SAMKB_DICDI Probable serine/threonine-protein kinase samkB OS=Dictyostelium discoideum GN=samkB PE=3 SV=1 5 288 3.0E-21
sp|B4LDJ6|PLK4_DROVI Serine/threonine-protein kinase PLK4 OS=Drosophila virilis GN=SAK PE=3 SV=1 5 293 3.0E-21
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 7 310 3.0E-21
sp|O96013|PAK4_HUMAN Serine/threonine-protein kinase PAK 4 OS=Homo sapiens GN=PAK4 PE=1 SV=1 8 312 3.0E-21
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 7 288 3.0E-21
sp|Q9JIH7|WNK1_RAT Serine/threonine-protein kinase WNK1 OS=Rattus norvegicus GN=Wnk1 PE=1 SV=2 6 288 3.0E-21
sp|P52564|MP2K6_HUMAN Dual specificity mitogen-activated protein kinase kinase 6 OS=Homo sapiens GN=MAP2K6 PE=1 SV=1 4 295 3.0E-21
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 6 288 4.0E-21
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 13 281 4.0E-21
sp|Q9SIQ7|CDPKO_ARATH Calcium-dependent protein kinase 24 OS=Arabidopsis thaliana GN=CPK24 PE=2 SV=1 6 337 4.0E-21
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 6 281 4.0E-21
sp|O61125|STK4_DICDI Serine/threonine-protein kinase 4 homolog A OS=Dictyostelium discoideum GN=krsA PE=1 SV=1 7 293 4.0E-21
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase catalytic subunit alpha OS=Bos taurus GN=PRKACA PE=1 SV=3 5 281 4.0E-21
sp|P28583|CDPK_SOYBN Calcium-dependent protein kinase SK5 OS=Glycine max PE=1 SV=1 7 284 4.0E-21
sp|Q16W24|PLK4_AEDAE Serine/threonine-protein kinase PLK4 OS=Aedes aegypti GN=SAK PE=3 SV=1 5 294 4.0E-21
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 5 288 2.0E-13
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 11 288 7.0E-12
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 5 293 2.0E-10
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 160 293 3.0E-10
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 5 293 6.0E-10
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 160 293 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0044238 primary metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4842
MSSEDKYDTLEKIGHGSFGVIRKVRRKTDGFIMCRKEISYLRMSQKEREQLHAEFQILSHLRHPNIVAYYHREHL
KISQDLHLYMEYCGNGDLGRVIKDLQHKGQRAQESFVWSIFSQLVMALYRCHYGVDPPEVGANVLGLTQGSASGS
PKVPAGTMTILHRDLKPENVFLGEDNSVKLGDFGLSKMIKSHDFASTYVGTPFYMSPEICAAEKYTLKSDIWSLG
CIMYELCAREPPFNAKTHFQLVQRIKEGKIAPLPDMYSPELYQVIKDCLRVNPDRRPDTAQLLGLPVVRLMRKEK
EVVDLNKSLRAREESLKRKEKEVSERLAGLEREKTAAREELDASLRREWEVKARLEIDRLANAEMEQLQKRFEDE
VRARVEAEVQRRRAVAFVPDEAAAAAAAAQPDEYGSSVAKSDYPRSSVGASGDEFPSTTDMTDCSLDSPDSSREA
KRSTRTPFGRAQTMFAGTPMDVEMASPSPMAIASLSLSPRRNGTTKAPTTHAGNIFAAAAHGARKWDVHREPTLT
DSDDEDVVPTGRC*
Coding >Hirsu2|4842
ATGTCGTCCGAGGACAAGTACGATACGTTGGAGAAGATCGGCCATGGCTCCTTCGGCGTCATTCGCAAGGTCCGC
CGAAAGACGGACGGCTTCATCATGTGCCGCAAAGAAATCTCGTACCTCCGCATGTCGCAAAAGGAGCGCGAGCAG
CTCCACGCCGAGTTCCAGATCCTCTCCCACCTCCGACACCCCAACATCGTCGCCTACTACCACCGCGAGCATCTC
AAAATCAGCCAGGACCTGCATCTGTACATGGAATACTGCGGCAACGGCGACCTCGGCCGCGTCATCAAAGACCTG
CAGCACAAGGGCCAGAGGGCGCAGGAGAGCTTCGTGTGGAGCATCTTCAGCCAGCTCGTCATGGCGCTGTACCGC
TGCCACTACGGCGTCGACCCGCCCGAGGTCGGGGCCAACGTGCTGGGCCTGACGCAGGGCAGCGCCAGCGGAAGC
CCCAAGGTGCCGGCGGGCACCATGACGATCCTCCATCGTGACCTCAAGCCGGAGAACGTGTTTCTCGGCGAGGAC
AATTCGGTCAAGCTCGGGGACTTTGGTCTGTCCAAGATGATCAAGTCGCACGACTTCGCCTCGACCTACGTCGGC
ACGCCCTTTTACATGTCGCCGGAGATTTGCGCGGCGGAGAAGTACACGCTCAAGTCGGACATTTGGTCGCTCGGA
TGCATCATGTACGAGCTCTGCGCGCGCGAGCCGCCCTTCAACGCCAAGACGCACTTTCAGCTGGTGCAGAGGATC
AAGGAGGGCAAGATTGCGCCGCTGCCGGACATGTACTCGCCCGAGCTGTACCAGGTGATCAAGGACTGCCTGCGG
GTGAACCCGGACCGGCGGCCGGACACGGCGCAGCTGCTCGGCCTGCCGGTGGTGAGGCTGATGCGCAAGGAGAAG
GAGGTGGTGGACCTCAACAAGTCGCTCCGGGCGCGGGAGGAGTCGCTCAAGCGCAAGGAGAAGGAGGTGAGCGAG
CGGCTGGCCGGGCTGGAGCGGGAGAAGACGGCGGCGCGGGAGGAGCTGGACGCGTCGCTGCGGCGGGAGTGGGAG
GTCAAGGCGCGGCTGGAGATTGACCGGCTGGCCAACGCGGAGATGGAGCAGCTGCAGAAGCGGTTCGAGGACGAG
GTGCGGGCGCGCGTCGAGGCCGAGGTGCAGCGGCGGCGGGCGGTGGCGTTTGTGCCGGACGAGGCGGCGGCGGCG
GCGGCGGCGGCGCAGCCGGACGAGTACGGCTCCTCGGTGGCCAAGTCGGACTACCCGCGGTCGTCGGTCGGGGCC
AGCGGCGACGAGTTCCCGTCGACGACGGACATGACGGACTGCTCGCTCGACAGCCCGGACTCGTCGCGCGAGGCC
AAGCGCAGCACGCGGACGCCGTTCGGGCGGGCGCAGACGATGTTCGCCGGCACGCCCATGGACGTGGAGATGGCG
TCGCCCAGCCCGATGGCCATCGCGTCGCTGTCGCTGTCGCCGCGGCGCAACGGCACGACCAAGGCGCCGACGACG
CACGCCGGCAACATCTTCGCGGCGGCGGCCCACGGGGCGCGCAAGTGGGACGTGCACCGCGAGCCGACGCTGACG
GACTCGGACGACGAGGACGTGGTGCCGACCGGCCGGTGCTGA
Transcript >Hirsu2|4842
ATGTCGTCCGAGGACAAGTACGATACGTTGGAGAAGATCGGCCATGGCTCCTTCGGCGTCATTCGCAAGGTCCGC
CGAAAGACGGACGGCTTCATCATGTGCCGCAAAGAAATCTCGTACCTCCGCATGTCGCAAAAGGAGCGCGAGCAG
CTCCACGCCGAGTTCCAGATCCTCTCCCACCTCCGACACCCCAACATCGTCGCCTACTACCACCGCGAGCATCTC
AAAATCAGCCAGGACCTGCATCTGTACATGGAATACTGCGGCAACGGCGACCTCGGCCGCGTCATCAAAGACCTG
CAGCACAAGGGCCAGAGGGCGCAGGAGAGCTTCGTGTGGAGCATCTTCAGCCAGCTCGTCATGGCGCTGTACCGC
TGCCACTACGGCGTCGACCCGCCCGAGGTCGGGGCCAACGTGCTGGGCCTGACGCAGGGCAGCGCCAGCGGAAGC
CCCAAGGTGCCGGCGGGCACCATGACGATCCTCCATCGTGACCTCAAGCCGGAGAACGTGTTTCTCGGCGAGGAC
AATTCGGTCAAGCTCGGGGACTTTGGTCTGTCCAAGATGATCAAGTCGCACGACTTCGCCTCGACCTACGTCGGC
ACGCCCTTTTACATGTCGCCGGAGATTTGCGCGGCGGAGAAGTACACGCTCAAGTCGGACATTTGGTCGCTCGGA
TGCATCATGTACGAGCTCTGCGCGCGCGAGCCGCCCTTCAACGCCAAGACGCACTTTCAGCTGGTGCAGAGGATC
AAGGAGGGCAAGATTGCGCCGCTGCCGGACATGTACTCGCCCGAGCTGTACCAGGTGATCAAGGACTGCCTGCGG
GTGAACCCGGACCGGCGGCCGGACACGGCGCAGCTGCTCGGCCTGCCGGTGGTGAGGCTGATGCGCAAGGAGAAG
GAGGTGGTGGACCTCAACAAGTCGCTCCGGGCGCGGGAGGAGTCGCTCAAGCGCAAGGAGAAGGAGGTGAGCGAG
CGGCTGGCCGGGCTGGAGCGGGAGAAGACGGCGGCGCGGGAGGAGCTGGACGCGTCGCTGCGGCGGGAGTGGGAG
GTCAAGGCGCGGCTGGAGATTGACCGGCTGGCCAACGCGGAGATGGAGCAGCTGCAGAAGCGGTTCGAGGACGAG
GTGCGGGCGCGCGTCGAGGCCGAGGTGCAGCGGCGGCGGGCGGTGGCGTTTGTGCCGGACGAGGCGGCGGCGGCG
GCGGCGGCGGCGCAGCCGGACGAGTACGGCTCCTCGGTGGCCAAGTCGGACTACCCGCGGTCGTCGGTCGGGGCC
AGCGGCGACGAGTTCCCGTCGACGACGGACATGACGGACTGCTCGCTCGACAGCCCGGACTCGTCGCGCGAGGCC
AAGCGCAGCACGCGGACGCCGTTCGGGCGGGCGCAGACGATGTTCGCCGGCACGCCCATGGACGTGGAGATGGCG
TCGCCCAGCCCGATGGCCATCGCGTCGCTGTCGCTGTCGCCGCGGCGCAACGGCACGACCAAGGCGCCGACGACG
CACGCCGGCAACATCTTCGCGGCGGCGGCCCACGGGGCGCGCAAGTGGGACGTGCACCGCGAGCCGACGCTGACG
GACTCGGACGACGAGGACGTGGTGCCGACCGGCCGGTGCTGA
Gene >Hirsu2|4842
ATGTCGTCCGAGGACAAGTACGATACGTTGGAGAAGATCGGTACGTCTGCGCAGCCGCTCGGGGGAGACGTGCTG
CTGTTGTCCCAGCCGCGGCGCTTCCCGCTTCCCCTTCCGGGCATGGGAGACGTCGGCCGGGCCTCGTTTGCGGCA
ACGACAACTGACGGTGCCTGTGCAGGCCATGGCTCCTTCGGCGTCATTCGCAAGGTCCGCCGAAAGACGGACGGC
TTCATCATGTGCCGCAAAGAAATCTCGTACCTCCGCATGTCGCAAAAGGAGCGCGAGCAGCTCCACGCCGAGTTC
CAGATCCTCTCCCACCTCCGACACCCCAACATCGTCGCCTACTACCACCGCGAGCATCTCAAAATCAGCCAGGAC
CTGCATCTGTACATGGAATACTGCGGCAACGGCGACCTCGGCCGCGTCATCAAAGACCTGCAGCACAAGGGCCAG
AGGGCGCAGGAGAGCTTCGTGTGGAGCATCTTCAGCCAGCTCGTCATGGCGCTGTACCGCTGCCACTACGGCGTC
GACCCGCCCGAGGTCGGGGCCAACGTGCTGGGCCTGACGCAGGGCAGCGCCAGCGGAAGCCCCAAGGTGCCGGCG
GGCACCATGACGATCCTCCATCGTGACCTCAAGCCGGAGAACGGTACGTGCCGCGGCTCGGGCCCGTCTGCCCGC
TCCCCCCCTCAGTGGCCTCTGCGGGCGAGCCAGCCGTGTCAGTAACTGACGAGGCCGGCCCAGTGTTTCTCGGCG
AGGACAATTCGGTCAAGCTCGGGGACTTTGGTCTGTCCAAGATGATCAAGTCGCACGACTTCGCCTCGACCTACG
TCGGCACGCCCTTTTACATGTCGCCGGAGATTTGCGCGGCGGAGAAGTACACGCTCAAGTCGGACATTTGGTCGC
TCGGATGCATCATGTACGAGCTCTGCGCGCGCGAGCCGCCCTTCAACGCCAAGACGCACTTTCAGCTGGTGCAGA
GGATCAAGGAGGGCAAGATTGCGCCGCTGCCGGACATGTACTCGCCCGAGCTGTACCAGGTGATCAAGGACTGCC
TGCGGGTGAACCCGGACCGGCGGCCGGACACGGCGCAGCTGCTCGGCCTGCCGGTGGTGAGGCTGATGCGCAAGG
AGAAGGAGGTGGTGGACCTCAACAAGTCGCTCCGGGCGCGGGAGGAGTCGCTCAAGCGCAAGGAGAAGGAGGTGA
GCGAGCGGCTGGCCGGGCTGGAGCGGGAGAAGACGGCGGCGCGGGAGGAGCTGGACGCGTCGCTGCGGCGGGAGT
GGGAGGTCAAGGCGCGGCTGGAGATTGACCGGCTGGCCAACGCGGAGATGGAGCAGCTGCAGAAGCGGTTCGAGG
ACGAGGTGCGGGCGCGCGTCGAGGCCGAGGTGCAGCGGCGGCGGGCGGTGGCGTTTGTGCCGGACGAGGCGGCGG
CGGCGGCGGCGGCGGCGCAGCCGGACGAGTACGGCTCCTCGGTGGCCAAGTCGGACTACCCGCGGTCGTCGGTCG
GGGCCAGCGGCGACGAGTTCCCGTCGACGACGGACATGACGGACTGCTCGCTCGACAGCCCGGACTCGTCGCGCG
AGGCCAAGCGCAGCACGCGGACGCCGTTCGGGCGGGCGCAGACGATGTTCGCCGGCACGCCCATGGACGTGGAGA
TGGCGTCGCCCAGCCCGATGGCCATCGCGTCGCTGTCGCTGTCGCCGCGGCGCAACGGCACGACCAAGGCGCCGA
CGACGCACGCCGGCAACATCTTCGCGGCGGCGGCCCACGGGGCGCGCAAGTGGGACGTGCACCGCGAGCCGACGC
TGACGGACTCGGACGACGAGGACGTGGTGCCGTCGCCGACGCGCCACATCAAGTCGTCCAAGAACCCGTTCACGT
CCAAGGACCGGCCGGTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail