Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4837
Gene name
LocationContig_2436:914..1994
Strand-
Gene length (bp)1080
Transcript length (bp)720
Coding sequence length (bp)720
Protein length (aa) 240

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02353 CMAS Mycolic acid cyclopropane synthetase 6.3E-23 1 139
PF08241 Methyltransf_11 Methyltransferase domain 1.2E-16 39 137
PF13649 Methyltransf_25 Methyltransferase domain 3.7E-16 38 133
PF13847 Methyltransf_31 Methyltransferase domain 9.8E-13 33 138
PF13489 Methyltransf_23 Methyltransferase domain 2.0E-10 25 156
PF08242 Methyltransf_12 Methyltransferase domain 6.0E-10 39 135
PF05175 MTS Methyltransferase small domain 1.5E-07 23 149
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 1.2E-04 33 137

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5C9L6|CNMT_THLFG (S)-coclaurine N-methyltransferase OS=Thalictrum flavum subsp. glaucum PE=1 SV=1 1 235 2.0E-53
sp|Q7XB08|CNMT_PAPSO (S)-coclaurine N-methyltransferase OS=Papaver somniferum GN=CNMT PE=1 SV=1 1 236 8.0E-50
sp|C3SBS8|TNMT_ESCCA (S)-tetrahydroprotoberberine N-methyltransferase OS=Eschscholzia californica PE=1 SV=1 1 236 4.0E-37
sp|C3SBW0|PNMT_THLFG Pavine N-methyltransferase OS=Thalictrum flavum subsp. glaucum PE=1 SV=1 1 235 8.0E-37
sp|Q108P1|TNMT_PAPSO (S)-tetrahydroprotoberberine N-methyltransferase OS=Papaver somniferum PE=1 SV=1 1 236 4.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5C9L6|CNMT_THLFG (S)-coclaurine N-methyltransferase OS=Thalictrum flavum subsp. glaucum PE=1 SV=1 1 235 2.0E-53
sp|Q7XB08|CNMT_PAPSO (S)-coclaurine N-methyltransferase OS=Papaver somniferum GN=CNMT PE=1 SV=1 1 236 8.0E-50
sp|C3SBS8|TNMT_ESCCA (S)-tetrahydroprotoberberine N-methyltransferase OS=Eschscholzia californica PE=1 SV=1 1 236 4.0E-37
sp|C3SBW0|PNMT_THLFG Pavine N-methyltransferase OS=Thalictrum flavum subsp. glaucum PE=1 SV=1 1 235 8.0E-37
sp|Q108P1|TNMT_PAPSO (S)-tetrahydroprotoberberine N-methyltransferase OS=Papaver somniferum PE=1 SV=1 1 236 4.0E-34
sp|C3SBU5|TNMT1_PAPBR (S)-tetrahydroprotoberberine N-methyltransferase 1 OS=Papaver bracteatum PE=1 SV=1 1 236 2.0E-33
sp|C3SBU4|TNMT2_PAPBR Probable (S)-tetrahydroprotoberberine N-methyltransferase 2 OS=Papaver bracteatum PE=2 SV=1 1 236 1.0E-32
sp|P0A9H7|CFA_ECOLI Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli (strain K12) GN=cfa PE=1 SV=2 1 229 1.0E-16
sp|P0A9H8|CFA_ECOL6 Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cfa PE=3 SV=2 1 229 1.0E-16
sp|O69687|FAMT_MYCTU Probable fatty acid methyltransferase Rv3720 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3720 PE=1 SV=4 1 217 5.0E-12
sp|Q8KZ94|REBMT_NOCAE Demethylrebeccamycin-D-glucose O-methyltransferase OS=Lechevalieria aerocolonigenes GN=rebM PE=1 SV=1 31 137 8.0E-11
sp|Q6MX39|UMAA_MYCTU S-adenosylmethionine-dependent methyltransferase UmaA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=umaA PE=1 SV=1 1 218 2.0E-10
sp|A5U866|CMAS1_MYCTA Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=cmaA1 PE=1 SV=1 3 218 5.0E-10
sp|P31049|FAMT_PSEPU Probable fatty acid methyltransferase OS=Pseudomonas putida PE=3 SV=1 1 138 5.0E-10
sp|P9WPB7|CMAS1_MYCTU Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cmaA1 PE=1 SV=1 3 218 5.0E-10
sp|P9WPB6|CMAS1_MYCTO Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cmaA1 PE=3 SV=1 3 218 8.0E-10
sp|P9WPB3|CMAS3_MYCTU Cyclopropane mycolic acid synthase 3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pcaA PE=1 SV=1 3 218 2.0E-09
sp|P9WPB2|CMAS3_MYCTO Cyclopropane mycolic acid synthase 3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pcaA PE=3 SV=1 3 218 2.0E-09
sp|Q9KJ20|GSDMT_ACTHA Glycine/sarcosine/dimethylglycine N-methyltransferase OS=Actinopolyspora halophila PE=1 SV=1 7 136 3.0E-09
sp|Q5APD4|C9MT_CANAL Sphingolipid C9-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MTS1 PE=1 SV=1 10 210 1.0E-08
sp|Q759S7|ERG6_ASHGO Sterol 24-C-methyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG6 PE=3 SV=1 29 138 3.0E-08
sp|Q7U1K1|MMAA4_MYCBO Hydroxymycolate synthase MmaA4 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaA PE=1 SV=1 3 239 1.0E-07
sp|I1RNL0|C9MT2_GIBZE Sphingolipid C9-methyltransferase 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MT2 PE=3 SV=1 1 225 2.0E-07
sp|C4R7Z3|C9MT_PICPG Sphingolipid C9-methyltransferase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr4_0465 PE=1 SV=1 1 225 2.0E-07
sp|B8DBZ5|MENG_LISMH Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=menG PE=3 SV=1 32 135 2.0E-07
sp|Q79FX8|MMAA4_MYCTU Hydroxymycolate synthase MmaA4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA4 PE=1 SV=1 3 239 4.0E-07
sp|Q9TYP1|STRM1_CAEEL Sterol 4-C-methyltransferase strm-1 OS=Caenorhabditis elegans GN=strm-1 PE=3 SV=2 16 138 4.0E-07
sp|A5U027|MMAA4_MYCTA Hydroxymycolate synthase MmaA4 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA4 PE=1 SV=1 3 239 4.0E-07
sp|I1RJD6|C9MT1_GIBZE Sphingolipid C9-methyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MT1 PE=3 SV=1 1 225 5.0E-07
sp|Q9P3R1|ERG6_NEUCR Sterol 24-C-methyltransferase erg-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-4 PE=3 SV=1 32 138 5.0E-07
sp|Q7U4Z9|SDMT_SYNPX Dimethylglycine N-methyltransferase OS=Synechococcus sp. (strain WH8102) GN=bsmB PE=1 SV=1 7 133 6.0E-07
sp|H2E7T6|SQMT2_BOTBR Squalene methyltransferase 2 OS=Botryococcus braunii GN=TMT-2 PE=1 SV=1 19 133 8.0E-07
sp|Q483C9|CMOA_COLP3 tRNA (cmo5U34)-methyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=cmoA PE=3 SV=1 8 137 9.0E-07
sp|Q6C2D9|ERG6_YARLI Sterol 24-C-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERG6 PE=3 SV=1 29 138 9.0E-07
sp|C1KWN1|MENG_LISMC Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=menG PE=3 SV=1 32 135 1.0E-06
sp|P67056|MENG_LISIN Demethylmenaquinone methyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menG PE=3 SV=1 32 135 1.0E-06
sp|Q71Y84|MENG_LISMF Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menG PE=3 SV=1 32 135 1.0E-06
sp|P67055|MENG_LISMO Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menG PE=3 SV=1 32 135 1.0E-06
sp|A0AK43|MENG_LISW6 Demethylmenaquinone methyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=menG PE=3 SV=1 32 135 1.0E-06
sp|Q96WX4|ERG6_PNECA Sterol 24-C-methyltransferase OS=Pneumocystis carinii GN=erg6 PE=2 SV=1 30 133 1.0E-06
sp|Q49807|CMAS2_MYCLE Cyclopropane mycolic acid synthase 2 OS=Mycobacterium leprae (strain TN) GN=cmaA2 PE=3 SV=1 1 218 2.0E-06
sp|C5D3E5|MENG_GEOSW Demethylmenaquinone methyltransferase OS=Geobacillus sp. (strain WCH70) GN=menG PE=3 SV=1 27 135 2.0E-06
sp|Q6BRB7|ERG6_DEBHA Sterol 24-C-methyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERG6 PE=3 SV=1 29 138 2.0E-06
sp|P0CH91|MMAA3_MYCTU Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA3 PE=1 SV=1 3 138 2.0E-06
sp|A5U028|MMAA3_MYCTA Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA3 PE=1 SV=1 3 138 2.0E-06
sp|Q7U1K0|MMAA3_MYCBO Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaB PE=1 SV=1 3 138 2.0E-06
sp|Q7U1J9|MMAA2_MYCBO Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaC PE=1 SV=1 3 138 5.0E-06
sp|P9WPB5|CMAS2_MYCTU Cyclopropane mycolic acid synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cmaA2 PE=1 SV=1 1 218 1.0E-05
sp|P9WPB4|CMAS2_MYCTO Cyclopropane mycolic acid synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cmaA2 PE=3 SV=1 1 218 1.0E-05
sp|P0A5P1|CMAS2_MYCBO Cyclopropane mycolic acid synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaA2 PE=3 SV=1 1 218 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4837
MKYSSCLYPTGNETLGQAEEAMLRSYLDKAELEDGMSILDLGCGWGSGSLFFAERLPNSRVTAFSNSRTQKQYID
AEVTRRGLTNVIVVTGNIVDFDFEHASFDRVVSIELFEHMKNYELLMAKVSRALKPGGKLFVHIGGTMPSADLLL
YFQGQLKIQRQWWVNGMHYSRTCEDWLSSMTANKRQIWPHLVETYGAQDAAAWYNRWQVFYMACSELFAYEGGDT
WGLVHNLFEKPPAA*
Coding >Hirsu2|4837
ATGAAGTATTCGTCATGTCTATATCCCACGGGCAATGAGACGCTCGGCCAAGCCGAGGAGGCCATGCTCCGGTCT
TATTTAGATAAGGCGGAGTTAGAGGACGGCATGAGCATACTCGACCTCGGGTGCGGATGGGGCTCGGGGTCTTTA
TTTTTTGCCGAGAGGCTCCCAAACTCTCGTGTCACCGCCTTTTCCAATTCGCGGACTCAGAAGCAGTATATCGAT
GCTGAGGTCACTCGCCGAGGCCTGACAAACGTCATAGTCGTGACGGGCAATATCGTCGATTTCGATTTCGAGCAC
GCGAGTTTTGACCGTGTCGTGTCTATCGAGTTGTTTGAGCATATGAAAAATTATGAGCTGCTTATGGCCAAAGTT
TCGCGAGCGCTGAAGCCTGGTGGCAAGCTCTTTGTACACATCGGTGGCACGATGCCTTCGGCCGACCTGTTATTA
TATTTCCAGGGGCAGCTCAAGATCCAGAGGCAGTGGTGGGTCAATGGGATGCATTATTCCCGAACTTGTGAGGAC
TGGCTGTCGTCTATGACAGCCAACAAGAGGCAGATATGGCCTCACTTGGTGGAGACTTATGGTGCACAGGACGCG
GCGGCGTGGTACAATAGATGGCAAGTCTTCTACATGGCTTGCTCGGAATTATTTGCATACGAAGGCGGCGACACA
TGGGGATTAGTACATAATTTATTTGAGAAGCCTCCTGCGGCATAA
Transcript >Hirsu2|4837
ATGAAGTATTCGTCATGTCTATATCCCACGGGCAATGAGACGCTCGGCCAAGCCGAGGAGGCCATGCTCCGGTCT
TATTTAGATAAGGCGGAGTTAGAGGACGGCATGAGCATACTCGACCTCGGGTGCGGATGGGGCTCGGGGTCTTTA
TTTTTTGCCGAGAGGCTCCCAAACTCTCGTGTCACCGCCTTTTCCAATTCGCGGACTCAGAAGCAGTATATCGAT
GCTGAGGTCACTCGCCGAGGCCTGACAAACGTCATAGTCGTGACGGGCAATATCGTCGATTTCGATTTCGAGCAC
GCGAGTTTTGACCGTGTCGTGTCTATCGAGTTGTTTGAGCATATGAAAAATTATGAGCTGCTTATGGCCAAAGTT
TCGCGAGCGCTGAAGCCTGGTGGCAAGCTCTTTGTACACATCGGTGGCACGATGCCTTCGGCCGACCTGTTATTA
TATTTCCAGGGGCAGCTCAAGATCCAGAGGCAGTGGTGGGTCAATGGGATGCATTATTCCCGAACTTGTGAGGAC
TGGCTGTCGTCTATGACAGCCAACAAGAGGCAGATATGGCCTCACTTGGTGGAGACTTATGGTGCACAGGACGCG
GCGGCGTGGTACAATAGATGGCAAGTCTTCTACATGGCTTGCTCGGAATTATTTGCATACGAAGGCGGCGACACA
TGGGGATTAGTACATAATTTATTTGAGAAGCCTCCTGCGGCATAA
Gene >Hirsu2|4837
ATGAAGTATTCGTCATGTCTATATCCCACGGGCAATGAGACGCTCGGCCAAGCCGAGGAGGCCATGCTCCGGTCT
TATTTAGATAAGGCGGAGTTAGAGGACGGCATGAGCATACTCGACCTCGGGTAAGTTTGCCCACGTCTGCCGGGG
GCCAGAAGGAGGTACCCCAGATCAAACAAGTATGGCTTTGCATCGACCAGGTTGCAGTCAAGCACACTTATCACT
CCCGCTAAGCAAACTATGGATCGATCCAGGTGCGGATGGGGCTCGGGGTCTTTATTTTTTGCCGAGAGGCTCCCA
AACTCTCGTGTCACCGCCTTTTCCAATTCGCGGACTCAGAAGCAGTATATCGATGCTGAGGTCACTCGCCGAGGC
CTGACAAACGTCATAGTCGTGACGGGCAATATCGTCGATTTCGATTTCGAGCACGCGAGTTTTGACCGTGTCGTG
TCTATCGAGGCAAGTGGATTTTCCAATCTCAAACTGTTCACGGCGCCTCAACGGCAAGCCTAACTCGAGAGGGGC
CTCACGCTGTCCATCGCCTGGCCAGTTGTTTGAGCATATGAAAAATTATGAGCTGCTTATGGCCAAAGTTTCGCG
AGCGCTGAAGCCTGGTGGCAAGCTCTTTGTACACATGTTCGCTCACCGAACGACGCCATATGATTACGAGGAGGG
CTGGATGACAACTCATTTTTTTAGCGGTGGCACGATGCCTTCGGCCGACCTGTTATTATATTTCCAGGGGCAGCT
CAAGATCCAGAGGCAGTGGTGGGTCAATGGGATGCATTATTCCCGAACTTGTGAGGTGAGTGTTGGACGATTGAG
TCAAAAATGTCGCCACATGATGGTCACCTACTAACTTGTGCAACGATGTACCATCAGGACTGGCTGTCGTCTATG
ACAGCCAACAAGAGGCAGATATGGCCTCACTTGGTGGAGACTTATGGTGCACAGGACGCGGCGGCGTGGTACAAT
AGATGGCAAGTCTTCTACATGGCTTGCTCGGAATTATTTGCATACGAAGGCGGCGACACATGGGGATTAGTACAT
AATTTATTTGAGAAGCCTCCTGCGGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail